Recombinant Human Olfactory receptor 6P1 (OR6P1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Olfactory Receptor 6P1

Olfactory receptor 6P1 (OR6P1) belongs to the extensive family of olfactory receptors that interact with odorant molecules in the nasal cavity. These interactions initiate neuronal responses that ultimately trigger the perception of smell in the brain . OR6P1 is classified as a G-protein-coupled receptor (GPCR) that arises from a single coding-exon gene . Like other members of this family, OR6P1 exhibits a characteristic 7-transmembrane domain structure, which it shares with many neurotransmitter and hormone receptors .

Nomenclature and Identification

OR6P1 is officially known as "olfactory receptor, family 6, subfamily P, member 1" but is also referred to by several alternative names:

  • Olfactory receptor OR1-12

  • Olfactory receptor family 6 subfamily P member 1

  • Seven transmembrane helix receptor

The protein is uniquely identified through several database entries:

Identifier TypeValue
UniProt Primary AccessionQ8NGX9
UniProt Secondary AccessionQ6IFR9
NCBI GeneID128366
NCBI AccessionNP_001153797.1
NCBI GenBank NucleotideNM_001160325.1
RefSeq AccessionNP_001153797.1

Physiological Function

The primary function of OR6P1 is to act as an odorant receptor . When specific odorant molecules bind to the receptor in the nasal epithelium, they trigger a conformational change that activates associated G-proteins. This activation initiates a signaling cascade that ultimately leads to the perception of specific odors .

As summarized by the NCBI, "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell" . This process forms the molecular basis of our sense of smell, enabling the discrimination between thousands of different odors.

Signaling Pathway

OR6P1, like other olfactory receptors, operates through a G protein-mediated transduction pathway . The activation of the receptor by an odorant molecule leads to:

  1. Conformational changes in the receptor structure

  2. Activation of associated G-proteins

  3. Stimulation of adenylyl cyclase

  4. Increased intracellular cAMP levels

  5. Opening of cyclic nucleotide-gated ion channels

  6. Membrane depolarization

  7. Generation of action potentials

  8. Signal transmission to the olfactory bulb and higher brain centers

Expression Systems

Recombinant human OR6P1 protein can be produced using various expression systems. One common approach utilizes mammalian cell lines such as HEK-293 cells, which provide the appropriate cellular machinery for proper protein folding and post-translational modifications . These expression systems are particularly valuable for producing structurally intact and functionally active OR6P1 protein.

Purification Tags and Methods

Recombinant OR6P1 proteins are typically engineered with affinity tags to facilitate isolation and purification. Common configurations include:

FeatureDetails
Tag TypesHis tag, Strep tag
Tag PositionsN-terminal and/or C-terminal
Purification MethodOne-step affinity chromatography
Typical Purity>90% as determined by Bis-Tris Page, Western Blot

The protein can contain an N-terminal tag and may also include a C-terminal tag, with tag types determined by factors such as tag-protein stability . Purification is commonly achieved through affinity chromatography, taking advantage of these engineered tags to isolate the protein of interest from cellular components .

Basic Olfactory Research

Recombinant OR6P1 provides researchers with a valuable tool for investigating the molecular mechanisms of olfaction. By studying the binding properties and activation characteristics of this receptor, scientists can gain insights into how different odors are detected and discriminated at the molecular level .

Applied Research Potential

Research on OR6P1 has potential applications in several fields:

  1. Fragrance Industry: Understanding the molecular basis of odor perception can inform the development of new fragrances and odorant compounds .

  2. Neurobiology: Studies involving OR6P1 contribute to our broader understanding of sensory neurobiology and signal transduction mechanisms .

  3. Biomedical Applications: As a member of the GPCR family, insights gained from OR6P1 research may have implications for understanding other GPCR systems, which are targets for approximately 40% of all modern medicines.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR6P1; Olfactory receptor 6P1; Olfactory receptor OR1-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6P1
Target Protein Sequence
MRNLSGGHVEEFVLVGFPTTPPLQLLLFVLFFAIYLLTLLENALIVFTIWLAPSLHRPMY FFLGHLSFLELWYINVTIPRLLAAFLTQDGRVSYVGCMTQLYFFIALACTECVLLAVMAY DRYLAICGPLLYPSLMPSSLATRLAAASWGSGFFSSMMKLLFISQLSYCGPNIINHFFCD ISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYTAIIAAILRIPTSRGRHKAFST CAAHLAVVVIYYSSTLFTYARPRAMYTFNHNKIISVLYTIIVPFFNPAIYCLRNKEVKEA FRKTVMGRCHYPRDVQD
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15036

KEGG: hsa:128366

STRING: 9606.ENSP00000334721

UniGene: Hs.723122

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR6P1 and how is it classified?

OR6P1 (Olfactory receptor 6P1, also known as Olfactory receptor OR1-12) belongs to the Class O2 (tetrapod specific odorant) Olfactory receptor family 6. It functions as an odorant receptor that interacts with odorant molecules in the nose to initiate neuronal responses that trigger smell perception . OR6P1 is currently categorized among targets about which relatively little is known (Tdark category), with limited published literature (Pubmed score: 0.28) and no established Gene RIFs .

What is the molecular structure of OR6P1?

OR6P1 is a G protein-coupled receptor (GPCR) with the characteristic seven-transmembrane domain structure. The protein sequence begins with an N-terminal region, followed by seven transmembrane domains (TM1-TM7) connected by alternating intracellular and extracellular loops . The complete amino acid sequence is available in protein databases, with specific structural motifs that are conserved among class O2 olfactory receptors. As with many ORs, detailed three-dimensional structural information remains limited due to challenges in crystallization of membrane proteins.

What is currently known about physiological ligands for OR6P1?

Currently, no physiological ligands have been definitively identified for OR6P1 . This classifies it as an "orphan receptor" - a receptor whose endogenous ligand(s) remain unknown. The identification of natural and synthetic ligands represents a significant knowledge gap in OR6P1 research. Similar olfactory receptors like OR6M1 have had ligands identified through techniques such as surface plasmon resonance (SPR) screening against chemical libraries .

What are the recommended methods for recombinant expression of OR6P1?

For successful recombinant expression of OR6P1, researchers should consider the following methodology:

  • Vector Construction: Design an expression vector containing the OR6P1 gene with appropriate tags (e.g., GST) to aid in purification and detection. The GST tag can be fused to the N-terminus of OR6P1 .

  • Chaperone Co-expression: Include receptor-transporting proteins (RTPs), particularly RTP1, in the expression system to facilitate proper folding and membrane trafficking. This is critical as ORs generally show poor surface expression in heterologous cells without chaperones .

  • Expression System Selection: HEK293T/17 cells have been successfully used for expressing similar olfactory receptors. After transfection, select stable expressors using appropriate antibiotics (e.g., puromycin at 5 μg/mL) .

  • Confirmation of Expression: Verify successful expression through immunofluorescence using antibodies against the fusion tag and western blotting techniques .

How can researchers overcome challenges in membrane localization of OR6P1?

Unlike many other GPCRs, olfactory receptors require specific chaperone proteins to facilitate successful surface expression. To overcome the challenge of poor membrane localization:

  • Co-express OR6P1 with receptor-transporting proteins such as RTP1, RTP2, or REEP1. Among these, RTP1 or its shorter form RTP1s has shown particular effectiveness in facilitating OR membrane expression .

  • Consider using a bicistronic vector system that allows simultaneous expression of both OR6P1 and the chaperone protein from a single transcript, such as the pIRES system .

  • Evaluate membrane localization through immunofluorescence by fixing cells with 4% paraformaldehyde, then using primary antibodies against the tag (e.g., GST) followed by fluorescently-labeled secondary antibodies .

  • Compare expression efficiency in different cell lines, as some may provide a more favorable environment for proper OR6P1 folding and trafficking.

What methods can be used to identify potential ligands for orphan OR6P1?

For identifying potential ligands for orphan receptors like OR6P1, a multi-tiered approach similar to that used for OR6M1 is recommended:

  • Primary Screening: Employ surface plasmon resonance (SPR) biosensor systems with immobilized OR6P1-expressing whole cells. This allows for direct observation of binding between the receptor and potential ligands .

  • Secondary Screening: Prepare OR6P1-expressing membrane fragments (average size ~120-150 nm) and immobilize them on SPR chips for higher sensitivity screening. Membrane fragments provide several advantages over whole cells:

    • Reduced size (approximately 70-times smaller than whole cells)

    • Decreased nonspecific binding

    • Improved assay sensitivity

    • Maintained receptor structural stability

  • Confirmation Assays: Following identification of potential ligands through SPR, verify functional activity using calcium imaging assays in OR6P1-expressing cells that co-express appropriate signaling components .

How can calcium imaging be optimized for OR6P1 functional studies?

To optimize calcium imaging for OR6P1 functional studies:

  • Cell Preparation: Use Hana3A cells (which stably express RTP1, RTP2, and REEP1) or similarly prepared cells transiently transfected with OR6P1 expression constructs .

  • Calcium Indicator Loading: Incubate cells with calcium-sensitive dyes such as Fluo-4 AM in a buffer containing physiological concentrations of calcium.

  • Experimental Setup: Mount cells in a perfusion chamber on a fluorescence microscope equipped with appropriate excitation/emission filters.

  • Response Measurement: Record baseline fluorescence before applying potential ligands, then monitor changes in fluorescence intensity that indicate calcium influx.

  • Data Analysis: Calculate the relative fluorescence change (ΔF/F0) for quantification of responses to different compounds at various concentrations.

  • Agonist/Antagonist Classification: Classify compounds that increase calcium influx as agonists, while those that block agonist-induced calcium influx can be classified as antagonists .

What techniques are currently applicable for studying OR6P1 structure?

Given the challenges in crystallizing membrane proteins, especially GPCRs, the following approaches are recommended for structural studies of OR6P1:

  • Homology Modeling: Create computational models based on crystal structures of other GPCRs, taking into account the known seven-transmembrane domain structure of OR6P1 .

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology and may be applicable to OR6P1, particularly if it can be stabilized in detergent micelles or nanodiscs.

  • Site-Directed Mutagenesis: Systematically alter specific residues predicted to be involved in ligand binding or receptor activation to indirectly probe the structure-function relationship.

  • Molecular Dynamics Simulations: Use computational approaches to simulate OR6P1 behavior in a membrane environment, providing insights into dynamic structural changes.

How should researchers design an SPR-based screening approach for OR6P1 ligand discovery?

To design an effective SPR-based screening approach for OR6P1 ligand discovery:

  • Biosensor Preparation:

    • Generate stable OR6P1-expressing cell lines using the methodology described in Section 2.1

    • For cell-based biosensors, immobilize OR6P1-expressing cells by covalent bonding between cell surface aldehyde groups and carbohydrazide on the SPR chip surface

    • For membrane fragment biosensors, isolate membrane fragments from OR6P1-expressing cells and immobilize them on the SPR chip

  • Screening Protocol:

    • Select a diverse chemical library for screening

    • Run compounds at appropriate concentrations (e.g., 15-25 μM)

    • Monitor SPR response (ΔRU) over time (typically 900-1100 seconds)

    • Compare binding to OR6P1-expressing cells/fragments versus control cells/fragments

    • Perform concentration-dependent binding studies for hit confirmation

  • Data Analysis:

    • Identify compounds that show specific binding to OR6P1 over controls

    • Calculate binding parameters such as association and dissociation rates

    • Prioritize hits showing concentration-dependent responses

What controls are essential for validating OR6P1 ligand binding assays?

For rigorous validation of OR6P1 ligand binding assays, the following controls are essential:

  • Negative Controls:

    • Non-transfected parental cells (e.g., HEK293T/17) to control for non-specific binding

    • Membrane fragments from non-transfected cells

    • Known non-ligands for olfactory receptors

  • Positive Controls:

    • If available, structurally related olfactory receptors with known ligands

    • Concentration gradients of potential ligands to demonstrate dose-dependency

    • Competitive binding assays once initial ligands are identified

  • Validation Steps:

    • Verify protein expression levels between test and control samples

    • Ensure consistent immobilization levels on SPR chips

    • Conduct multiple independent experiments to ensure reproducibility

How might OR6P1 be relevant to cancer research based on studies of related olfactory receptors?

Based on findings with the related receptor OR6M1, OR6P1 may have potential relevance to cancer research:

  • Expression Analysis: Researchers should first determine whether OR6P1 is expressed in various cancer cell lines at both the mRNA level (using PCR) and protein level (using western blotting), similar to how OR6M1 was identified in MCF-7 breast cancer cells .

  • Functional Role Investigation: If OR6P1 is expressed in cancer cells, researchers should investigate its potential role in:

    • Cell proliferation and viability

    • Cell migration and invasion

    • Apoptotic pathways

    • Cell cycle regulation

  • Therapeutic Potential: Should OR6P1 ligands be identified, they could be evaluated for anticancer activity. For instance, the OR6M1 agonist anthraquinone (AQ) was found to induce death of MCF-7 cells, suggesting that olfactory receptors may represent novel anticancer targets .

What methods can be used to investigate OR6P1's potential role in cancer cells?

To investigate OR6P1's potential role in cancer:

  • Expression Analysis:

    • Perform RT-PCR and qPCR to quantify OR6P1 mRNA expression

    • Use western blotting with specific antibodies to detect protein expression

    • Apply immunohistochemistry to localize OR6P1 in tissue samples

  • Functional Assays:

    • Cell Viability: Use MTT or MTS assays to measure cell proliferation after OR6P1 activation or inhibition

    • Apoptosis Detection: Employ flow cytometry with Annexin V/PI staining to quantify apoptotic cells

    • Migration Assays: Utilize wound healing or transwell assays to assess effects on cell migration

    • Signaling Pathway Analysis: Investigate downstream signaling using phosphorylation-specific antibodies for key pathway proteins

  • Genetic Manipulation:

    • Perform siRNA or shRNA knockdown of OR6P1 to observe phenotypic changes

    • Create OR6P1 overexpression models to study gain-of-function effects

How can researchers determine the signaling pathways activated by OR6P1?

To elucidate signaling pathways downstream of OR6P1 activation:

  • G Protein Coupling Analysis:

    • Perform [35S]GTPγS binding assays to determine which G protein subtypes couple with OR6P1

    • Use selective G protein inhibitors to examine their effects on OR6P1-mediated responses

    • Employ BRET (Bioluminescence Resonance Energy Transfer) assays to directly measure OR6P1-G protein interactions

  • Second Messenger Measurements:

    • Monitor cAMP levels using ELISA or FRET-based sensors to assess Gαs/Gαi coupling

    • Measure IP3 production and calcium mobilization to evaluate Gαq coupling

    • Examine β-arrestin recruitment using protein complementation assays

  • Kinase Activation Profiling:

    • Assess phosphorylation of ERK1/2, PKA, PKC, and other kinases via western blotting

    • Employ kinase inhibitors to determine the importance of specific pathways

    • Use phospho-specific antibody arrays to broadly profile kinase activation

What are the best approaches for developing selective OR6P1 modulators?

For development of selective OR6P1 modulators:

  • Structure-Based Design:

    • Generate homology models of OR6P1 based on available GPCR crystal structures

    • Perform in silico docking studies to identify potential binding pockets

    • Utilize molecular dynamics simulations to understand ligand-receptor interactions

  • High-Throughput Screening Optimization:

    • Develop cell-based functional assays suitable for high-throughput format

    • Screen diverse chemical libraries against OR6P1-expressing cells

    • Implement counter-screening against related ORs to assess selectivity

  • Medicinal Chemistry Approaches:

    • Once hit compounds are identified, establish structure-activity relationships

    • Synthesize focused libraries around promising scaffolds

    • Optimize for potency, selectivity, and drug-like properties

  • Validation Studies:

    • Confirm binding using biophysical methods like SPR

    • Verify functional activity through calcium imaging or other signaling assays

    • Assess selectivity against a panel of related olfactory receptors

What are the key challenges in working with recombinant OR6P1?

Researchers working with recombinant OR6P1 should be aware of these key challenges:

ChallengeDescriptionPotential Solutions
Surface ExpressionPoor trafficking to the plasma membraneCo-express with chaperones like RTP1; Add N-terminal tags that enhance trafficking
Structural StabilityDifficulty maintaining native conformationUse membrane fragments rather than solubilized protein; Optimize detergent conditions
Orphan StatusUnknown endogenous ligandsApply broad screening approaches; Consider structural similarity to related ORs with known ligands
Functional AssaysSignal-to-noise limitations in activity assaysOptimize assay conditions; Use multiple orthogonal assay formats
Protein YieldLow expression levelsTest different expression systems; Optimize codon usage for expression host

How should researchers approach contradictory results in OR6P1 studies?

When encountering contradictory results in OR6P1 research:

  • Methodological Evaluation:

    • Compare experimental conditions across studies, including expression systems, tags, and assay formats

    • Assess the impact of different chaperone proteins on OR6P1 function

    • Consider cell type-specific factors that might influence receptor behavior

  • Statistical Rigor:

    • Ensure adequate replication and appropriate statistical analyses

    • Evaluate effect sizes rather than focusing solely on statistical significance

    • Consider power calculations to determine if sample sizes are sufficient

  • Orthogonal Validation:

    • Confirm key findings using multiple, independent methodologies

    • Employ both binding and functional assays to corroborate results

    • Verify antibody specificity through appropriate controls

  • Contextual Factors:

    • Assess the impact of receptor density on signaling outcomes

    • Consider the influence of cellular microenvironment on receptor function

    • Evaluate potential differences between recombinant systems and native contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.