Recombinant Human Olfactory receptor 6Q1 (OR6Q1)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptor 6Q1 (OR6Q1)

Olfactory Receptor 6Q1, also known as OR11-226, is a protein encoded by the OR6Q1 gene in humans. This receptor belongs to the extensive family of olfactory receptors, which are essential components of the olfactory system responsible for the detection and discrimination of various odors . The olfactory receptors function by interacting with odorant molecules in the nasal cavity, initiating a neuronal response that ultimately triggers the perception of smell .

As a member of the G-protein-coupled receptor (GPCR) superfamily, OR6Q1 features the characteristic seven-transmembrane domain structure common to many neurotransmitter and hormone receptors . These receptors play a crucial role in the recognition and G-protein-mediated transduction of odorant signals, forming the molecular basis for our sense of smell . The olfactory receptor gene family is notably the largest in the human genome, highlighting the complexity and diversity of olfactory perception mechanisms .

OR6Q1 is classified as a multi-pass membrane protein, embedded within the cell membrane of olfactory sensory neurons . The gene encoding this receptor consists of more than 900 base pairs and is located on human chromosome 11q12.1 . Notably, chromosome 11 houses over 1,400 genes and comprises nearly 4% of the human genome, associating it with several genetic disorders including Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome .

Amino Acid Sequence and Protein Structure

The full-length human OR6Q1 protein consists of 317 amino acids . The complete amino acid sequence, as provided in commercial products, is:

MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRPMYFFLTHLSCLEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLAAMAYDRYVAICMPLHYGAFVSWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDHFSCDASPLLALSCSDVTWKETVDFLVSLAVLLASSMVIAVSYGNIVWTLLHIRSAAERWKAFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVFSLNFWKGQ

This sequence determines the three-dimensional structure of the protein, which includes the characteristic seven-transmembrane domain arrangement typical of GPCRs . The transmembrane domains are connected by intracellular and extracellular loops, with specific regions involved in ligand binding and G-protein interaction.

Genetic Information and Cellular Localization

The OR6Q1 gene maps to human chromosome 11q12.1, a region associated with various genetic disorders . The protein product is primarily localized to the cell membrane as a multi-pass membrane protein . It has been assigned the GeneID 219952 and Human Swiss-Prot Number Q8NGQ2 . On Western blot analysis, OR6Q1 typically appears as a band of approximately 36 kDa .

Like other olfactory receptors, OR6Q1 is expressed in olfactory sensory neurons within the main olfactory epithelium. Each mature olfactory sensory neuron is thought to express only one allele of a single olfactory receptor gene, contributing to the specificity of odor detection .

Expression Systems and Production Methods

Recombinant Human OR6Q1 protein can be produced using various expression systems, with Escherichia coli being one of the most common hosts . The recombinant protein is often engineered with fusion tags, such as the N-terminal histidine (His) tag, to facilitate purification and detection .

The production process typically involves transforming the host cells with an expression vector containing the OR6Q1 gene, inducing protein expression, and subsequently purifying the recombinant protein using affinity chromatography. The purified protein is then typically lyophilized to ensure stability during storage .

Research Applications

Recombinant OR6Q1 protein serves as a valuable tool for various research applications, including:

  1. Functional studies of olfactory perception mechanisms

  2. Investigation of G-protein coupled receptor signaling pathways

  3. Development of therapeutic approaches targeting olfactory receptors

  4. Antibody production and validation

  5. Structural studies of olfactory receptors

Recent research has focused on characterizing the promoter architecture of olfactory receptor genes, contributing to our understanding of their transcriptional regulation . Such studies have mapped promoters for a significant percentage of olfactory receptor genes and identified candidate transcription factors involved in their expression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR6Q1; Olfactory receptor 6Q1; Olfactory receptor OR11-226
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6Q1
Target Protein Sequence
MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRP MYFFLTHLSCLEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLA AMAYDRYVAICMPLHYGAFVSWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDH FSCDASPLLALSCSDVTWKETVDFLVSLAVLLASSMVIAVSYGNIVWTLLHIRSAAERWK AFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKE VKGALGRVFSLNFWKGQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15302

KEGG: hsa:219952

STRING: 9606.ENSP00000307734

UniGene: Hs.690432

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR6Q1 and what is its structural classification?

OR6Q1 (also known as olfactory receptor OR11-226) is a 317 amino acid multi-pass membrane protein belonging to the G protein-coupled receptor 1 (GPCR) family . The receptor is encoded by the OR6Q1 gene (GeneID: 219952) located on human chromosome 11q12.1 . Structurally, OR6Q1 exhibits the characteristic seven-transmembrane domain architecture common to other GPCRs, with its protein structure enabling interaction with odorant molecules and subsequent G protein-mediated signal transduction .

The receptor's cellular localization is primarily in the cell membrane, where it functions as a chemosensor . According to UniProt database information (Swiss-Prot No: Q8NGQ2), OR6Q1 is categorized within the broader olfactory receptor family, which comprises approximately 400 functional genes in humans .

What expression systems are most effective for studying OR6Q1?

Multiple expression systems have been developed for studying olfactory receptors like OR6Q1, each with specific advantages:

1. Mammalian Cell Systems:

  • HEK293-derived cells (particularly Hana3A cells) have proven most effective for OR6Q1 expression

  • These cells are engineered to express chaperone proteins RTP1, RTP2, and REEP1, significantly improving cell surface expression of ORs

  • Particularly efficient is RTP1S, a C-terminal shortened version of RTP1, which shows enhanced ability to facilitate OR surface expression

2. Yeast-based Systems:

  • Saccharomyces cerevisiae offers an alternative platform for OR6Q1 expression with several optimization strategies

Optimization ApproachStrategyDetails
Improved ExpressionPromoter strength modificationAdjusting gene copy number, codon optimization, and Kozak sequence enhancement
Enhanced Membrane InsertionSignal sequence additionUsing mating factor secretion signal or rhodopsin N-terminal amino acids
Membrane CompositionCholesterol incorporationMimicking mammalian membrane environment
GPCR/Gα CouplingAlternative Gα proteinsSwapping C-terminal amino acids of GPA1 with human Gα

These expression systems can be selected based on specific experimental requirements, with HEK293/Hana3A cells being preferred for detailed functional studies and yeast systems offering advantages for high-throughput screening applications.

What are the challenges in expressing functional OR6Q1 in heterologous systems?

Expressing functional OR6Q1 in heterologous systems presents several significant challenges that researchers must address:

  • Poor Cell Surface Trafficking:

    • Olfactory receptors, including OR6Q1, often remain trapped in the endoplasmic reticulum when expressed in heterologous systems

    • This results in minimal cell surface expression, making functional studies difficult

  • Protein Misfolding:

    • ORs frequently misfold when expressed outside their native environment

    • This necessitates the use of specialized chaperone proteins to facilitate proper folding

  • G-protein Coupling Issues:

    • OR6Q1 naturally couples to olfactory-specific G protein (Gαolf) in sensory neurons

    • In heterologous systems, this coupling is often inefficient, requiring co-expression of Gαolf or creation of chimeric G proteins

  • Signal Transduction Limitations:

    • Detection of OR activation requires sensitive reporter systems

    • cAMP generation must be efficiently detected, requiring specialized tools like GloSensor™ luciferase

  • Receptor Internalization:

    • Rapid receptor internalization following activation can limit sustained signaling

    • Co-expression of M3 muscarinic acetylcholine receptor has been shown to suppress β-arrestin 2-mediated OR internalization

To overcome these challenges, researchers have developed specialized experimental approaches including N-terminal tagging systems (Rho-tag, Lucy-tag, IL-6-Halo-tag), co-expression with accessory proteins, and optimized detection methods .

What tagging systems improve OR6Q1 surface expression?

Several tagging systems have been developed to enhance the surface expression of olfactory receptors like OR6Q1, each offering distinct advantages:

  • Rho-tag (Rhodopsin-derived signal peptide):

    • One of the first tags developed to improve OR trafficking

    • Functions by adding the first 20 amino acids of rhodopsin to the N-terminus of ORs

    • Works well in combination with RTP1/RTP2 chaperones in Hana3A cells

  • Lucy-tag:

    • More effective than the Rho-tag for many ORs

    • Enables cell surface expression of a wider range of ORs

    • Particularly useful for difficult-to-express receptors

  • IL-6-Halo-tag:

    • Recently developed system with improved performance

    • Combines interleukin-6 signal sequence with the HaloTag protein

    • Offers advantages in trafficking and detection capabilities

  • N-terminal modification approaches in yeast systems:

    • Integration of first amino acids of rhodopsin into coding sequence

    • Swapping N-terminus with that of Ste2 (yeast pheromone receptor)

    • These modifications significantly enhance membrane insertion efficiency

The choice of tagging system depends on the specific experimental goals, with the Lucy-tag and IL-6-Halo-tag generally offering superior performance for challenging receptors like OR6Q1 .

How does copy-number variation affect OR6Q1 function and olfactory perception?

Copy-number variation (CNV) of olfactory receptor genes, including OR6Q1, has significant implications for olfactory perception diversity among individuals:

  • Prevalence of CNV in the OR Gene Family:

    • The olfactory receptor gene family shows extensive copy-number variation across human populations

    • Research combining multiplex ligation-dependent probe amplification (MLPA) and PCR has confirmed CNV in numerous OR genes

  • Functional Consequences of OR6Q1 CNV:

    • Variation in OR6Q1 copy number directly impacts the density of receptor expression

    • Higher copy numbers typically correlate with enhanced sensitivity to specific odorants recognized by OR6Q1

    • Some individuals possess functional OR6Q1 alleles while others may have non-functional pseudogene variants

  • Research Methodologies for Studying OR6Q1 CNV:

    • MLPA combined with PCR provides reliable quantification of OR gene copy numbers

    • Whole-genome sequencing approaches can identify large-scale CNVs

    • Targeted approaches using digital PCR offer precise quantification of specific OR genes

  • Evolutionary Implications:

    • Both homology-based and homology-independent processes have contributed to remodeling the OR gene family

    • This has significant implications for understanding the evolution of human olfactory perception

  • Clinical Relevance:

    • OR6Q1 variants have been associated with specific anosmias (inability to detect certain odors)

    • Understanding CNV in OR6Q1 may help explain individual differences in olfactory perception and potential links to neurological conditions

The study of OR6Q1 CNV provides valuable insights into the genetic basis of olfactory perception variation and has implications for personalized approaches to sensory research.

What methodologies exist for deorphanizing OR6Q1?

Deorphanization—identifying ligands that activate OR6Q1—requires sophisticated methodologies that have evolved significantly in recent years:

  • Cell-Based Functional Assays:

    • Luciferase Reporter Systems:

      • Utilize cAMP-responsive luciferase reporters like GloSensor™

      • Provide real-time, highly sensitive detection of OR activation

      • Primarily conducted in Hana3A cells with necessary accessory proteins

    • Calcium Imaging:

      • Measures intracellular calcium flux upon receptor activation

      • Can be performed with fluorescent calcium indicators or genetically encoded calcium sensors

      • Enables spatial and temporal resolution of signaling

  • Yeast-Based High-Throughput Screening:

    • Growth-Based Selection:

      • Engineered yeast strains where OR activation leads to expression of essential genes

      • Allows screening of large chemical libraries

      • Demonstrated success in rapid deorphanization of human ORs

    • Fluorescence-Based Detection:

      • OR activation coupled to fluorescent reporter expression

      • Compatible with fluorescence-activated cell sorting (FACS) for high-throughput screening

      • Enables quantitative analysis of receptor activation

  • Computational and Machine Learning Approaches:

    • Structure-Based Virtual Screening:

      • Uses homology models of OR6Q1 to predict ligand binding

      • Molecular docking simulations identify potential agonists

      • Significantly narrows the chemical space for experimental validation

    • Machine Learning Prediction Models:

      • Leverages existing OR-ligand interaction data to predict new ligands

      • Support vector machine algorithms have shown success in predicting OR activators

      • Can achieve hit rates of 39-50% for novel agonist identification

  • M2OR Database Integration:

    • The Molecule to Olfactory Receptor database contains curated data on OR-molecule interactions

    • Includes information on 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs

    • Valuable resource for identifying potential OR6Q1 ligands based on structural similarity to known agonists

The most effective deorphanization strategies typically combine computational prediction with experimental validation, significantly accelerating the discovery of OR6Q1 ligands.

How can OR6Q1 be utilized in biosensor development?

OR6Q1 presents significant potential for development as a biosensor platform, leveraging its specific molecular recognition properties:

  • Expression System Optimization for Biosensor Applications:

    • Selection of appropriate heterologous expression system is critical for biosensor development

    • Yeast-based systems offer particular advantages for sensor applications:

      • Robust growth in various conditions

      • Compatibility with diverse detection methods

      • Potential for whole-cell biosensor applications

  • Signal Transduction and Output Engineering:

    • Multiple signal output systems can be coupled to OR6Q1 activation:

    Output SystemDescriptionApplication Advantages
    FluorescenceGFP or other fluorescent protein expressionReal-time monitoring, quantitative analysis
    LuminescenceLuciferase-based reportingHigh sensitivity, low background
    AuxotrophicGrowth-dependent selectionHigh-throughput screening capabilities
    ColorimetricVisible color changeField-deployable applications, minimal instrumentation
  • Enhancing Sensitivity and Specificity:

    • Genetic modifications to improve ligand sensitivity:

      • Directed evolution approaches to generate OR6Q1 variants with enhanced affinity

      • Mutation of key binding pocket residues to alter selectivity

      • Chimeric receptors incorporating ligand binding domains with different specificities

  • Integration with Electronic Components:

    • OR6Q1-based biosensors can be integrated with electronic detection systems:

      • Field-effect transistors (FETs) measuring changes in surface potential upon receptor activation

      • Impedance-based systems detecting conformational changes in immobilized receptors

      • These approaches enable development of portable electronic nose systems

  • Real-World Applications:

    • Environmental monitoring for specific chemicals

    • Quality control in food and beverage industries

    • Medical diagnostics (detecting disease-specific volatile compounds)

    • These applications leverage OR6Q1's evolved sensitivity to specific odorant molecules

The development of OR6Q1-based biosensors represents a promising approach for creating highly sensitive and selective chemical detection systems with diverse applications in research and industry.

What is the role of accessory proteins in OR6Q1 signaling and trafficking?

Accessory proteins play crucial roles in facilitating OR6Q1 function through multiple mechanisms:

  • Receptor Trafficking Proteins (RTPs):

    • RTP1 and RTP1S (shortened variant):

      • Dramatically improve cell surface expression of OR6Q1

      • RTP1S shows enhanced efficiency compared to full-length RTP1

      • Critical for heterologous expression systems to achieve functional studies

    • RTP2:

      • Complements RTP1 function in promoting OR trafficking

      • Works synergistically with RTP1 in Hana3A cells

    • REEP1 (Receptor Expression-Enhancing Protein 1):

      • Facilitates ER export of ORs including OR6Q1

      • Important component of the Hana3A expression system

  • G Protein-Related Accessory Factors:

    • GNAL/Gαolf:

      • Olfactory-specific G protein α subunit with high affinity for ORs

      • Enhances signal transduction efficiency

      • Critical for physiological OR signaling

    • Ric-8B:

      • Functions as a guanine nucleotide exchange factor (GEF) for Gαolf

      • Enhances G protein coupling efficiency

      • Important for amplifying OR signaling

  • Co-expressed Non-OR GPCRs:

    • β2-adrenergic receptor:

      • Forms heterodimers with ORs including OR6Q1

      • Improves trafficking to cell surface

      • May alter signaling properties

    • M3 muscarinic acetylcholine receptor:

      • Suppresses β-arrestin 2-mediated OR internalization

      • Prolongs signaling duration

      • Enhances detection of OR activation in experimental systems

  • In Vivo Olfactory-Specific Factors:

    • Odorant Binding Proteins (OBPs):

      • Facilitate transport of hydrophobic odorants through aqueous mucus

      • May present odorants to ORs in optimal orientation

      • Important for physiological odor detection

The strategic co-expression of these accessory proteins has revolutionized OR6Q1 research by enabling functional expression in heterologous systems, with the combination of RTP1S, REEP1, and Gαolf providing optimal results in most experimental contexts .

How can computational approaches predict OR6Q1-ligand interactions?

Computational approaches have emerged as powerful tools for predicting OR6Q1-ligand interactions, significantly accelerating the discovery process:

  • Homology Modeling and Molecular Docking:

    • Creation of OR6Q1 structural models based on GPCR crystal structures

    • Refinement of models using molecular dynamics simulations

    • Docking of potential ligands to identify binding poses and interaction energies

    • These approaches can effectively narrow the search space for experimental validation

  • Machine Learning Prediction Models:

    • Support vector machine (SVM) algorithms have demonstrated success in predicting OR agonists

    • Using 4,884 chemical descriptors as input features for training models

    • Models can achieve impressive hit rates of 39-50% for novel agonist identification

    • This represents a significant improvement over random screening approaches

  • Chemical Space Analysis:

    • Principal component analysis (PCA) of chemical descriptors helps visualize the chemical space of OR ligands

    • Identification of chemical features that correlate with receptor activation

    • Clustering analysis reveals chemical families likely to activate OR6Q1

    • This approach guides the selection of test compounds for experimental validation

  • Integration with Experimental Data:

    • M2OR database integration enhances predictive capabilities:

      • Contains data on 75,050 bioassay experiments for OR-molecule interactions

      • Includes concentration-dependent responses and stereochemical information

      • Provides training data for machine learning models

  • Prediction of Structure-Activity Relationships:

    • Quantitative structure-activity relationship (QSAR) models identify key molecular features

    • Pharmacophore modeling reveals spatial arrangements of chemical features required for activity

    • These models guide the design of novel ligands with enhanced potency or selectivity

The combination of these computational approaches with targeted experimental validation represents the most efficient strategy for identifying novel OR6Q1 ligands and understanding the molecular basis of odorant recognition.

What experimental design considerations are important for OR6Q1 functional studies?

Effective OR6Q1 functional studies require careful experimental design considerations:

  • Concentration Range Selection:

    • Olfactory receptors, including OR6Q1, demonstrate concentration-dependent responses

    • Changes in odorant concentration can significantly alter receptor activation profiles

    • M2OR database indicates that screening concentrations and EC50 values are critical parameters

    • Testing across a wide concentration range (typically 10 nM to 1 mM) is essential to fully characterize receptor response

  • Stereochemistry Considerations:

    • Some ORs, like OR1A1, respond differently to enantiomers

    • Complete stereochemical information for test compounds is essential

    • M2OR database emphasizes the importance of specific stereoisomer testing

    • For OR6Q1 studies, using stereochemically pure compounds rather than racemic mixtures provides more reliable data

  • Appropriate Control Selection:

    • Positive controls: Known OR6Q1 agonists should be included to validate assay functionality

    • Negative controls:

      • Mock-transfected cells assess background signal

      • Non-responsive compounds verify assay specificity

      • Empty vector controls evaluate expression system effects

  • Cell Line and Expression System Considerations:

    • Assay-dependent bias must be considered:

      • HEK293/Hana3A cells are standard but may not recapitulate all aspects of native OSN signaling

      • LNCaP cells have identified ligands not detected in HEK293 cells

      • Multiple expression systems may be necessary for comprehensive deorphanization

  • Normalization and Data Analysis Approaches:

    • Dose-response curves should be generated for quantitative analysis

    • EC50 values provide standardized comparison between compounds

    • Maximum response (Emax) values indicate compound efficacy

    • Statistical methods must account for inherent variability in GPCR signaling

Careful attention to these experimental design considerations is essential for generating reliable and reproducible data on OR6Q1 function, particularly when comparing results across different studies or laboratories.

How do different G protein couplings affect OR6Q1 signaling outcomes?

The G protein coupling profile of OR6Q1 significantly impacts its signaling outcomes and experimental detection methods:

  • Natural G Protein Coupling Preferences:

    • In olfactory sensory neurons, OR6Q1 naturally couples to Gαolf (GNAL)

    • This coupling leads to adenylyl cyclase activation and cAMP production

    • The physiological response involves subsequent opening of cyclic nucleotide-gated channels

  • G Protein Coupling in Heterologous Systems:

    • Gαolf Expression:

      • Co-expression of Gαolf enhances signaling in heterologous systems

      • Improved coupling efficiency results in stronger cAMP responses

      • The GloSensor™ system provides sensitive detection of these responses

    • Alternative G Protein Couplings:

      • Some ORs exhibit promiscuous G protein coupling

      • OR activation can potentially trigger multiple downstream pathways:

        • Gαs → cAMP production

        • Gαq → calcium mobilization

        • Gαi → cAMP inhibition

  • G Protein Determinants of Ligand Specificity:

    • Research indicates that G protein coupling can affect ligand recognition:

      • Some ORs are activated by different ligands depending on the Gα subunit

      • Others show ligand-independent activation profiles regardless of G protein coupling

      • The specific scenario for OR6Q1 requires experimental determination

  • Engineered G Protein Systems:

    • In mammalian cells:

      • Co-expression of Gαolf enhances signaling sensitivity

      • Chimeric G proteins (e.g., Gα15/16) can redirect signaling to calcium pathways

    • In yeast systems:

      • Gαolf/GPA1 fusion proteins improve coupling to yeast signaling machinery

      • C-terminal swaps between human Gα and yeast GPA1 facilitate functional expression

      • These approaches enable detection of OR activation in yeast-based assays

  • Experimental Implications:

    • Selection of appropriate G protein co-expression is critical for experimental design

    • Multiple readout systems may be necessary to fully characterize OR6Q1 signaling

    • Validation across different G protein coupling systems provides more comprehensive understanding

Understanding the G protein coupling profile of OR6Q1 is essential for designing effective experimental systems and interpreting signaling outcomes in both research and biosensor applications.

What are the potential applications of OR6Q1 research beyond olfaction?

OR6Q1 research extends beyond traditional olfaction studies into several promising applications:

  • Biomedical Applications:

    • Disease Diagnostics:

      • Olfactory receptors can detect disease-specific volatile compounds

      • OR6Q1-based sensors could potentially identify biomarkers for specific conditions

      • Electronic nose systems incorporating multiple ORs including OR6Q1 offer comprehensive diagnostic capabilities

    • Drug Discovery:

      • OR6Q1 represents a GPCR target with potential pharmaceutical applications

      • Understanding its structure-function relationships informs GPCR drug design

      • The receptor's ligand binding properties may reveal novel therapeutic approaches

  • Environmental Monitoring:

    • Pollution Detection:

      • OR6Q1-based biosensors could detect specific environmental contaminants

      • Real-time monitoring applications for industrial emissions

      • Field-deployable sensors for environmental protection agencies

    • Water Quality Assessment:

      • Detection of trace contaminants in water supplies

      • Monitoring for specific industrial chemicals or agricultural runoff

      • OR6Q1's evolved sensitivity could enable detection beyond conventional methods

  • Food and Beverage Industry:

    • Quality Control:

      • Detection of specific aroma compounds indicative of product quality

      • Identification of spoilage markers before human detection

      • Standardized quality assessment independent of human sensory variation

    • Product Development:

      • Rational design of flavor compounds targeting specific receptors

      • Objective measurement of aroma profiles

      • Enhanced understanding of structure-activity relationships for flavor compounds

  • Fundamental GPCR Research:

    • OR6Q1 as a model system for studying:

      • GPCR trafficking mechanisms

      • Ligand binding dynamics

      • G protein coupling specificity

      • Signal transduction pathways

  • Evolutionary and Genomic Studies:

    • Investigation of genetic variation in OR6Q1 across populations

    • Understanding the evolutionary pressures on olfactory receptor diversity

    • Insights into human sensory perception evolution

These diverse applications highlight the broader impact of OR6Q1 research beyond basic olfactory studies, with potential contributions to medicine, environmental science, food technology, and fundamental biology.

How can emerging technologies enhance OR6Q1 research?

Emerging technologies are revolutionizing OR6Q1 research, offering new approaches for understanding its function and applications:

  • Advanced Structural Biology Techniques:

    • Cryo-Electron Microscopy (Cryo-EM):

      • Enables structural determination of membrane proteins in near-native states

      • Recent advances in resolution make it applicable to GPCR structures

      • Could reveal the first experimental structure of OR6Q1, advancing structure-based drug design

    • Single-Particle Analysis:

      • Characterizes conformational changes during receptor activation

      • Provides insights into dynamic aspects of ligand binding

      • Reveals structural basis for G protein coupling specificity

  • CRISPR-Cas9 Genome Editing:

    • Precise Genetic Modifications:

      • Creation of knock-in models expressing tagged OR6Q1 for in vivo studies

      • Generation of point mutations to study structure-function relationships

      • Development of reporter systems for in vivo activation studies

    • High-Throughput Mutagenesis:

      • Saturation mutagenesis to identify critical residues for ligand binding

      • Creation of OR6Q1 variant libraries with altered specificity profiles

      • Evolution of enhanced receptors for biosensor applications

  • Artificial Intelligence and Machine Learning:

    • Deep Learning Models:

      • Neural networks trained on large OR-ligand datasets

      • Improved prediction accuracy beyond traditional machine learning approaches

      • Integration of structural data with functional outcomes for comprehensive modeling

    • Automated Experimental Design:

      • AI-guided selection of test compounds for maximum information gain

      • Optimization of experimental conditions for receptor deorphanization

      • Reduction in experimental iterations required for comprehensive characterization

  • Single-Cell Technologies:

    • Single-Cell RNA Sequencing:

      • Characterization of OR6Q1 expression patterns in different cell types

      • Identification of co-expressed factors in native olfactory sensory neurons

      • Discovery of potential non-olfactory expression sites

    • Single-Cell Functional Analysis:

      • Microfluidic platforms for isolated cell functional studies

      • High-resolution imaging of receptor activation in individual cells

      • Correlation of genetic variation with functional outcomes

  • Synthetic Biology Approaches:

    • Cell-Free Expression Systems:

      • Rapid production of functional OR6Q1 for structural and functional studies

      • Bypass challenges associated with cellular expression systems

      • Enable high-throughput screening applications

    • Engineered Cellular Systems:

      • Development of optimized cellular chassis for OR expression

      • Synthetic signaling pathways with enhanced sensitivity and specificity

      • Programmable response outputs for diverse applications

These emerging technologies promise to accelerate OR6Q1 research by providing new tools for structural determination, functional characterization, and application development.

What are the current limitations in OR6Q1 research methodologies?

Despite significant advances, OR6Q1 research faces several important methodological limitations:

  • Expression System Challenges:

    • Limited Native-Like Environment:

      • Even optimized heterologous systems (Hana3A cells) do not fully recapitulate the native OSN environment

      • Membrane composition differences affect receptor conformation and function

      • This may lead to incomplete understanding of physiological ligand responses

    • Variable Expression Efficiency:

      • Expression levels can vary significantly between experiments

      • This creates challenges for standardization and reproducibility

      • Quantitative comparison between different receptors remains difficult

  • Assay Methodology Limitations:

    • Assay-Dependent Bias:

      • Different detection methods (luciferase, calcium imaging, etc.) can yield different results

      • Some ligands may be identified in one system but not another

      • This necessitates validation across multiple platforms but increases research complexity

    • Concentration Range Constraints:

      • Solubility limitations for hydrophobic compounds

      • Cytotoxicity at high concentrations

      • These factors restrict the testable concentration range for potential ligands

  • Data Interpretation Challenges:

    • Definition of "Responsive":

      • Lack of standardized thresholds for defining positive responses

      • Binary classification (agonist/non-agonist) may oversimplify complex partial agonist behaviors

      • EC50 values can vary significantly depending on experimental conditions

    • Promiscuity vs. Specificity:

      • Difficulty distinguishing physiologically relevant interactions from in vitro artifacts

      • High concentrations may activate receptors non-specifically

      • Determining the true physiological ligands remains challenging

  • Technical Barriers:

    • Limited Structural Information:

      • No experimental structures for OR6Q1 or close homologs

      • Homology models have inherent limitations in accuracy

      • This impedes structure-based approaches to receptor engineering

    • Limited Access to Pure Compounds:

      • Many potential odorants are unavailable as pure stereoisomers

      • Custom synthesis is expensive and time-consuming

      • This restricts comprehensive testing of chemical space

  • Translation to In Vivo Function:

    • Gap Between In Vitro and In Vivo:

      • In vitro identified ligands may not reflect in vivo activation patterns

      • Additional factors in the nasal environment affect odorant presentation

      • Perireceptor events modify odorant access to receptors

    • Complex Perception:

      • Difficulty correlating receptor activation with perceptual outcomes

      • The combinatorial nature of olfaction complicates single-receptor studies

      • Individual variation in receptor genetics further complicates interpretation

Addressing these limitations requires interdisciplinary approaches combining improved expression systems, standardized assay methodologies, and integration of in vitro and in vivo studies to fully elucidate OR6Q1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.