Olfactory Receptor 6Q1, also known as OR11-226, is a protein encoded by the OR6Q1 gene in humans. This receptor belongs to the extensive family of olfactory receptors, which are essential components of the olfactory system responsible for the detection and discrimination of various odors . The olfactory receptors function by interacting with odorant molecules in the nasal cavity, initiating a neuronal response that ultimately triggers the perception of smell .
As a member of the G-protein-coupled receptor (GPCR) superfamily, OR6Q1 features the characteristic seven-transmembrane domain structure common to many neurotransmitter and hormone receptors . These receptors play a crucial role in the recognition and G-protein-mediated transduction of odorant signals, forming the molecular basis for our sense of smell . The olfactory receptor gene family is notably the largest in the human genome, highlighting the complexity and diversity of olfactory perception mechanisms .
OR6Q1 is classified as a multi-pass membrane protein, embedded within the cell membrane of olfactory sensory neurons . The gene encoding this receptor consists of more than 900 base pairs and is located on human chromosome 11q12.1 . Notably, chromosome 11 houses over 1,400 genes and comprises nearly 4% of the human genome, associating it with several genetic disorders including Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome .
The full-length human OR6Q1 protein consists of 317 amino acids . The complete amino acid sequence, as provided in commercial products, is:
MQPYTKNWTQVTEFVMMGFAGIHEAHLLFFILFLTMYLFTLVENLAIILVVGLDHRLRRPMYFFLTHLSCLEIWYTSVTVPKMLAGFIGVDGGKNISYADCLSQLFIFTFLGATECFLLAAMAYDRYVAICMPLHYGAFVSWGTCIRLAAACWLVGFLTPILPIYLLSQLTFYGPNVIDHFSCDASPLLALSCSDVTWKETVDFLVSLAVLLASSMVIAVSYGNIVWTLLHIRSAAERWKAFSTCAAHLTVVSLFYGTLFFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVFSLNFWKGQ
This sequence determines the three-dimensional structure of the protein, which includes the characteristic seven-transmembrane domain arrangement typical of GPCRs . The transmembrane domains are connected by intracellular and extracellular loops, with specific regions involved in ligand binding and G-protein interaction.
The OR6Q1 gene maps to human chromosome 11q12.1, a region associated with various genetic disorders . The protein product is primarily localized to the cell membrane as a multi-pass membrane protein . It has been assigned the GeneID 219952 and Human Swiss-Prot Number Q8NGQ2 . On Western blot analysis, OR6Q1 typically appears as a band of approximately 36 kDa .
Like other olfactory receptors, OR6Q1 is expressed in olfactory sensory neurons within the main olfactory epithelium. Each mature olfactory sensory neuron is thought to express only one allele of a single olfactory receptor gene, contributing to the specificity of odor detection .
Recombinant Human OR6Q1 protein can be produced using various expression systems, with Escherichia coli being one of the most common hosts . The recombinant protein is often engineered with fusion tags, such as the N-terminal histidine (His) tag, to facilitate purification and detection .
The production process typically involves transforming the host cells with an expression vector containing the OR6Q1 gene, inducing protein expression, and subsequently purifying the recombinant protein using affinity chromatography. The purified protein is then typically lyophilized to ensure stability during storage .
Recombinant OR6Q1 protein serves as a valuable tool for various research applications, including:
Functional studies of olfactory perception mechanisms
Investigation of G-protein coupled receptor signaling pathways
Development of therapeutic approaches targeting olfactory receptors
Antibody production and validation
Structural studies of olfactory receptors
Recent research has focused on characterizing the promoter architecture of olfactory receptor genes, contributing to our understanding of their transcriptional regulation . Such studies have mapped promoters for a significant percentage of olfactory receptor genes and identified candidate transcription factors involved in their expression .
OR6Q1 (also known as olfactory receptor OR11-226) is a 317 amino acid multi-pass membrane protein belonging to the G protein-coupled receptor 1 (GPCR) family . The receptor is encoded by the OR6Q1 gene (GeneID: 219952) located on human chromosome 11q12.1 . Structurally, OR6Q1 exhibits the characteristic seven-transmembrane domain architecture common to other GPCRs, with its protein structure enabling interaction with odorant molecules and subsequent G protein-mediated signal transduction .
The receptor's cellular localization is primarily in the cell membrane, where it functions as a chemosensor . According to UniProt database information (Swiss-Prot No: Q8NGQ2), OR6Q1 is categorized within the broader olfactory receptor family, which comprises approximately 400 functional genes in humans .
Multiple expression systems have been developed for studying olfactory receptors like OR6Q1, each with specific advantages:
1. Mammalian Cell Systems:
HEK293-derived cells (particularly Hana3A cells) have proven most effective for OR6Q1 expression
These cells are engineered to express chaperone proteins RTP1, RTP2, and REEP1, significantly improving cell surface expression of ORs
Particularly efficient is RTP1S, a C-terminal shortened version of RTP1, which shows enhanced ability to facilitate OR surface expression
2. Yeast-based Systems:
Saccharomyces cerevisiae offers an alternative platform for OR6Q1 expression with several optimization strategies
These expression systems can be selected based on specific experimental requirements, with HEK293/Hana3A cells being preferred for detailed functional studies and yeast systems offering advantages for high-throughput screening applications.
Expressing functional OR6Q1 in heterologous systems presents several significant challenges that researchers must address:
Poor Cell Surface Trafficking:
Protein Misfolding:
G-protein Coupling Issues:
Signal Transduction Limitations:
Receptor Internalization:
To overcome these challenges, researchers have developed specialized experimental approaches including N-terminal tagging systems (Rho-tag, Lucy-tag, IL-6-Halo-tag), co-expression with accessory proteins, and optimized detection methods .
Several tagging systems have been developed to enhance the surface expression of olfactory receptors like OR6Q1, each offering distinct advantages:
Rho-tag (Rhodopsin-derived signal peptide):
Lucy-tag:
IL-6-Halo-tag:
N-terminal modification approaches in yeast systems:
The choice of tagging system depends on the specific experimental goals, with the Lucy-tag and IL-6-Halo-tag generally offering superior performance for challenging receptors like OR6Q1 .
Copy-number variation (CNV) of olfactory receptor genes, including OR6Q1, has significant implications for olfactory perception diversity among individuals:
Prevalence of CNV in the OR Gene Family:
Functional Consequences of OR6Q1 CNV:
Research Methodologies for Studying OR6Q1 CNV:
Evolutionary Implications:
Clinical Relevance:
The study of OR6Q1 CNV provides valuable insights into the genetic basis of olfactory perception variation and has implications for personalized approaches to sensory research.
Deorphanization—identifying ligands that activate OR6Q1—requires sophisticated methodologies that have evolved significantly in recent years:
Cell-Based Functional Assays:
Luciferase Reporter Systems:
Calcium Imaging:
Yeast-Based High-Throughput Screening:
Growth-Based Selection:
Fluorescence-Based Detection:
Computational and Machine Learning Approaches:
Structure-Based Virtual Screening:
Machine Learning Prediction Models:
M2OR Database Integration:
The most effective deorphanization strategies typically combine computational prediction with experimental validation, significantly accelerating the discovery of OR6Q1 ligands.
OR6Q1 presents significant potential for development as a biosensor platform, leveraging its specific molecular recognition properties:
Expression System Optimization for Biosensor Applications:
Signal Transduction and Output Engineering:
Multiple signal output systems can be coupled to OR6Q1 activation:
| Output System | Description | Application Advantages |
|---|---|---|
| Fluorescence | GFP or other fluorescent protein expression | Real-time monitoring, quantitative analysis |
| Luminescence | Luciferase-based reporting | High sensitivity, low background |
| Auxotrophic | Growth-dependent selection | High-throughput screening capabilities |
| Colorimetric | Visible color change | Field-deployable applications, minimal instrumentation |
Enhancing Sensitivity and Specificity:
Integration with Electronic Components:
OR6Q1-based biosensors can be integrated with electronic detection systems:
Real-World Applications:
The development of OR6Q1-based biosensors represents a promising approach for creating highly sensitive and selective chemical detection systems with diverse applications in research and industry.
Accessory proteins play crucial roles in facilitating OR6Q1 function through multiple mechanisms:
Receptor Trafficking Proteins (RTPs):
RTP1 and RTP1S (shortened variant):
RTP2:
REEP1 (Receptor Expression-Enhancing Protein 1):
G Protein-Related Accessory Factors:
GNAL/Gαolf:
Ric-8B:
Co-expressed Non-OR GPCRs:
β2-adrenergic receptor:
M3 muscarinic acetylcholine receptor:
In Vivo Olfactory-Specific Factors:
The strategic co-expression of these accessory proteins has revolutionized OR6Q1 research by enabling functional expression in heterologous systems, with the combination of RTP1S, REEP1, and Gαolf providing optimal results in most experimental contexts .
Computational approaches have emerged as powerful tools for predicting OR6Q1-ligand interactions, significantly accelerating the discovery process:
Homology Modeling and Molecular Docking:
Machine Learning Prediction Models:
Support vector machine (SVM) algorithms have demonstrated success in predicting OR agonists
Using 4,884 chemical descriptors as input features for training models
Models can achieve impressive hit rates of 39-50% for novel agonist identification
This represents a significant improvement over random screening approaches
Chemical Space Analysis:
Principal component analysis (PCA) of chemical descriptors helps visualize the chemical space of OR ligands
Identification of chemical features that correlate with receptor activation
Clustering analysis reveals chemical families likely to activate OR6Q1
This approach guides the selection of test compounds for experimental validation
Integration with Experimental Data:
Prediction of Structure-Activity Relationships:
The combination of these computational approaches with targeted experimental validation represents the most efficient strategy for identifying novel OR6Q1 ligands and understanding the molecular basis of odorant recognition.
Effective OR6Q1 functional studies require careful experimental design considerations:
Concentration Range Selection:
Olfactory receptors, including OR6Q1, demonstrate concentration-dependent responses
Changes in odorant concentration can significantly alter receptor activation profiles
M2OR database indicates that screening concentrations and EC50 values are critical parameters
Testing across a wide concentration range (typically 10 nM to 1 mM) is essential to fully characterize receptor response
Stereochemistry Considerations:
Some ORs, like OR1A1, respond differently to enantiomers
Complete stereochemical information for test compounds is essential
M2OR database emphasizes the importance of specific stereoisomer testing
For OR6Q1 studies, using stereochemically pure compounds rather than racemic mixtures provides more reliable data
Appropriate Control Selection:
Cell Line and Expression System Considerations:
Normalization and Data Analysis Approaches:
Careful attention to these experimental design considerations is essential for generating reliable and reproducible data on OR6Q1 function, particularly when comparing results across different studies or laboratories.
The G protein coupling profile of OR6Q1 significantly impacts its signaling outcomes and experimental detection methods:
Natural G Protein Coupling Preferences:
G Protein Coupling in Heterologous Systems:
Gαolf Expression:
Alternative G Protein Couplings:
G Protein Determinants of Ligand Specificity:
Engineered G Protein Systems:
In mammalian cells:
In yeast systems:
Experimental Implications:
Understanding the G protein coupling profile of OR6Q1 is essential for designing effective experimental systems and interpreting signaling outcomes in both research and biosensor applications.
OR6Q1 research extends beyond traditional olfaction studies into several promising applications:
Biomedical Applications:
Disease Diagnostics:
Drug Discovery:
Environmental Monitoring:
Pollution Detection:
Water Quality Assessment:
Food and Beverage Industry:
Quality Control:
Product Development:
Fundamental GPCR Research:
Evolutionary and Genomic Studies:
These diverse applications highlight the broader impact of OR6Q1 research beyond basic olfactory studies, with potential contributions to medicine, environmental science, food technology, and fundamental biology.
Emerging technologies are revolutionizing OR6Q1 research, offering new approaches for understanding its function and applications:
Advanced Structural Biology Techniques:
Cryo-Electron Microscopy (Cryo-EM):
Single-Particle Analysis:
CRISPR-Cas9 Genome Editing:
Precise Genetic Modifications:
High-Throughput Mutagenesis:
Artificial Intelligence and Machine Learning:
Deep Learning Models:
Automated Experimental Design:
Single-Cell Technologies:
Single-Cell RNA Sequencing:
Single-Cell Functional Analysis:
Synthetic Biology Approaches:
Cell-Free Expression Systems:
Engineered Cellular Systems:
These emerging technologies promise to accelerate OR6Q1 research by providing new tools for structural determination, functional characterization, and application development.
Despite significant advances, OR6Q1 research faces several important methodological limitations:
Expression System Challenges:
Limited Native-Like Environment:
Variable Expression Efficiency:
Assay Methodology Limitations:
Assay-Dependent Bias:
Concentration Range Constraints:
Data Interpretation Challenges:
Definition of "Responsive":
Promiscuity vs. Specificity:
Technical Barriers:
Limited Structural Information:
Limited Access to Pure Compounds:
Translation to In Vivo Function:
Gap Between In Vitro and In Vivo:
Complex Perception:
Addressing these limitations requires interdisciplinary approaches combining improved expression systems, standardized assay methodologies, and integration of in vitro and in vivo studies to fully elucidate OR6Q1 function.