Recombinant Human Olfactory receptor 6S1 (OR6S1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Challenges

OR6S1, like most olfactory receptors, is challenging to express recombinantly due to:

  • Cellular Localization: Requires chaperones (e.g., RTP1S) for proper membrane trafficking .

  • Low Solubility: Detergent-dependent extraction often leads to aggregation .

  • Functional Validation: Limited ligand-binding assays due to orphan status .

Studies on homologous receptors (e.g., OR1A1, OR6M1) suggest optimized protocols using:

  • HEK293 or LNCaP cell lines for stable expression .

  • Epitope tagging (e.g., FLAG, rho1D4) for detection and purification .

Functional Insights and Hypotheses

While OR6S1 remains deorphanized, insights from related receptors provide clues:

  • Ligand Specificity: Class II receptors typically detect hydrophobic odorants .

  • Signal Transduction: Likely activates Gα<sub>olf</sub>-mediated cAMP pathways .

  • Potential Roles:

    • Odor detection in the olfactory epithelium .

    • Extranasal roles in chemotaxis or cellular signaling, as observed for other ORs .

Key Unanswered Questions

  • What odorants or ligands activate OR6S1?

  • Does OR6S1 form homodimers or heterodimers?

  • What is its structural conformation in ligand-bound states?

Proposed Methodologies

ApproachApplication to OR6S1
Surface Plasmon Resonance (SPR)Screen odorant libraries for binding activity .
Cryo-EM or X-ray CrystallographyResolve atomic-level structure (as done for OR51E2) .
Calcium ImagingAssess G-protein activation in transfected Hana3A cells .

Comparative Analysis with Related Receptors

ReceptorLigands IdentifiedExpression SystemFunctional Role
OR6M1Anthraquinone, RutinHEK293, MCF-7 cellsApoptosis regulation in breast cancer
OR1A1DihydrojasmoneHEK293S cellsOdorant detection
OR51E2Short-chain fatty acidsHeterologous systemsMetabolic signaling

Implications for Drug Discovery

OR6S1’s potential as a therapeutic target hinges on:

  • Ligand Identification: High-throughput screening (HTS) of 50,000+ odorant pairs .

  • Disease Associations: Olfactory receptors are implicated in neurodegeneration and cancer .

  • Technical Advances: Improved heterologous expression systems (e.g., LNCaP cells for high-basal-activity ORs) .

Current Database Entries

  • GPCRdb: Classifies OR6S1 under family 6 with full sequence annotation .

  • Pharos: Labels OR6S1 as understudied (Knowledge Score: 0.32/1) .

  • M2OR Database: No recorded ligand pairs for OR6S1 as of 2023 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
OR6S1; Olfactory receptor 6S1; Olfactory receptor OR14-37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6S1
Target Protein Sequence
MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLTGNVLIVGVVRADTRLQTP MYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVM SADRYLAICHPLRYPLLMSGAVCFRVALACWVGGLVPVLGPTVAVALLPFCKQGAVVQHF FCDSGPLLRLACTNTKKLEETDFVLASLVIVSSLLITAVSYGLIVLAVLSIPSASGRQKA FSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQV KEALKDMFRKVVAGVLGNLLLDKCLSEKAVK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15363

KEGG: hsa:341799

STRING: 9606.ENSP00000313110

UniGene: Hs.513132

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 6S1 and how is it classified?

Human Olfactory Receptor 6S1 (OR6S1) belongs to the olfactory receptor family, which are class A G-protein-coupled receptors. These receptors constitute the largest transmembrane protein family in the human genome and play crucial roles in detecting odorant molecules in the environment. OR6S1 is one of approximately 400 functional olfactory receptors in humans, categorized within the larger family that includes other receptor types such as vomeronasal receptors, trace amine-associated receptors, formyl peptide receptors, and membrane guanylyl cyclase.

What expression systems are recommended for recombinant OR6S1 production?

For recombinant OR6S1 production, stable tetracycline-inducible HEK293S cell lines are highly recommended based on successful implementations with other human olfactory receptors. This expression system allows for controlled induction of receptor expression and has demonstrated success in producing sufficient quantities of properly folded receptors. The receptor should be engineered with appropriate epitope tags, such as a C-terminal rho1D4 epitope tag and an N-terminal FLAG epitope tag, to facilitate purification and detection. This approach typically yields between 1-2 mg of purified receptor protein from sixty T175 flasks of cultured cells, sufficient for most analytical studies.

How can I verify the functional activity of recombinant OR6S1?

The functional activity of recombinant OR6S1 can be verified through a real-time cAMP assay in heterologous expression systems. After expression in appropriate cell lines (such as HEK293S), measure cAMP production upon exposure to potential ligands. Additionally, proper folding can be confirmed using circular dichroism analysis, which provides information about the secondary structure of the protein. For ligand binding studies, intrinsic tryptophan fluorescence assays can be employed to quantify the binding affinity between the receptor and potential odorants, with successful binding typically occurring in the micromolar range for olfactory receptors.

What are the key variables to consider when designing OR6S1 experiments?

When designing experiments involving OR6S1, researchers must carefully define and control multiple variables to ensure valid results. The primary independent variables typically include the concentration of potential ligands, expression levels of OR6S1, and experimental conditions (pH, temperature, ionic strength). The dependent variables usually encompass receptor activation measures (cAMP levels, calcium signaling), binding affinity parameters, and downstream signaling effects. Potential confounding variables that must be controlled include endogenous receptor expression in the host cells, variability in transfection efficiency, and post-translational modifications of the recombinant protein.

Variable TypeExamples for OR6S1 ResearchMeasurement/Control Method
Independent VariablesLigand concentration, Expression levels, Buffer compositionPrecise preparation, Inducible promoter systems, Standardized buffers
Dependent VariablescAMP levels, Calcium flux, Binding affinityReal-time cAMP assays, Fluorescence-based calcium imaging, Tryptophan fluorescence quenching
Confounding VariablesEndogenous receptor expression, Cell passage number, Post-translational modificationsRT-qPCR validation, Consistent cell culture protocols, Western blot analysis

How should I approach the purification of recombinant OR6S1 for structural studies?

For structural studies of recombinant OR6S1, implement a two-step purification process starting with affinity chromatography followed by size exclusion chromatography. Begin with monoclonal anti-FLAG immunoaffinity purification to capture the tagged receptor from detergent-solubilized cell lysates. Subsequently, perform gel filtration to separate monomeric and dimeric forms of the receptor and remove any remaining contaminants. Critical considerations include selecting appropriate detergents that maintain receptor stability (typically mild non-ionic detergents like DDM or LMNG), optimizing solubilization conditions, and verifying proper folding via circular dichroism analysis. Size exclusion chromatography coupled with multi-angle light scattering can confirm the oligomeric state of the purified receptor, with both monomeric and dimeric forms typically observed.

What experimental designs best address the contradictions in OR6S1 expression data?

To address contradictions in OR6S1 expression data, employ a data-agnostic mindset that acknowledges all data sources have limitations. Implement a multi-method validation approach comparing results from different techniques such as qRT-PCR, Western blotting, and immunohistochemistry. Single-cell transcriptomics is particularly valuable as it can reveal nuanced expression patterns obscured in bulk tissue analysis due to the typically low expression levels of olfactory receptors. When contradictory results emerge, explore potential biological explanations such as cell type-specific expression, differentiation state dependencies, or combinatorial expression with other receptors rather than immediately dismissing one data source.

Experimental ApproachAdvantagesLimitationsApplication to OR6S1
Bulk Tissue AnalysisComprehensive tissue-level overviewMasks low expression in specific cellsPreliminary screening
Single-Cell TranscriptomicsReveals cell-specific expression patternsTechnical challenges in detecting low-abundance transcriptsDetailed expression mapping
Multi-method ValidationConfirms findings through independent techniquesResource-intensiveResolving contradictory data
Differentiation StudiesLinks expression to cell stateRequires careful temporal analysisUnderstanding expression dynamics

How should I interpret contradictory findings in OR6S1 ligand binding studies?

When encountering contradictory findings in OR6S1 ligand binding studies, approach the inconsistencies as valuable data points rather than errors to be reconciled. First, examine methodological differences between studies, including expression systems, protein preparation methods, and binding assay techniques. Subtle variations in receptor conformation due to different detergents or buffer conditions can significantly affect ligand binding properties. Consider that contradictions might reflect biological reality—OR6S1 may exhibit different binding profiles in different cellular contexts due to heteromeric interactions with other proteins or post-translational modifications. Implement multiple complementary binding assays such as intrinsic tryptophan fluorescence, isothermal titration calorimetry, and surface plasmon resonance to generate a comprehensive binding profile. Finally, develop models that integrate conflicting data rather than selecting a single "correct" result.

What statistical approaches are most appropriate for analyzing OR6S1 expression signatures across datasets?

For analyzing OR6S1 expression signatures across diverse datasets, implement robust statistical frameworks that account for the inherent variability in olfactory receptor expression. Begin with data normalization techniques specific to low-abundance transcripts, such as specialized RNA-Seq normalization methods that account for zero-inflation patterns common in olfactory receptor data. For comparative analyses across multiple datasets or cohorts, employ batch effect correction methods like ComBat or Harman. When constructing expression signatures involving OR6S1 and other olfactory receptors, utilize dimensionality reduction techniques such as PCA or t-SNE followed by unsupervised clustering to identify patterns. For survival analysis based on OR6S1 signatures, apply Cox proportional hazards models with robust feature selection to avoid overfitting. Finally, validate findings through bootstrapping or cross-validation approaches to ensure reproducibility across datasets.

What are the optimal conditions for functional reconstitution of purified OR6S1?

For functional reconstitution of purified OR6S1, optimize conditions that maintain the native conformation and signaling capabilities of the receptor. Begin with detergent-solubilized receptor purified from a stable expression system and select an appropriate lipid composition for reconstitution, typically including phosphatidylcholine, phosphatidylethanolamine, and cholesterol in ratios mimicking native membranes. For proteoliposome formation, employ a controlled detergent removal strategy using either dialysis or bio-beads, with detergent removal rates optimized for OR6S1 stability. Alternatively, consider nanodiscs or lipid cubic phase systems which have shown success with other GPCRs. Verify functional reconstitution through G-protein coupling assays, using either purified G-protein subunits or G-protein mimetics like mini-G proteins. The reconstituted receptor should exhibit ligand binding with affinities comparable to those observed in cell-based assays, typically in the micromolar range for olfactory receptors.

How can I design assays to identify specific ligands for OR6S1?

To identify specific ligands for OR6S1, implement a multi-tiered screening strategy combining computational prediction with experimental validation. Begin with in silico screening using molecular docking to predict potential ligands based on the binding pocket characteristics of OR6S1 or closely related olfactory receptors. For primary screening, develop a medium to high-throughput cell-based assay measuring G-protein-mediated signaling, such as calcium mobilization or cAMP production, in cells heterologously expressing OR6S1. Use appropriate positive controls (known ligands of structurally similar ORs) and negative controls (mock-transfected cells). Secondary validation should employ dose-response studies with lead compounds to determine EC50 values. For tertiary confirmation, utilize direct binding assays such as intrinsic tryptophan fluorescence to quantify binding affinities. Finally, implement cross-reactivity testing against related olfactory receptors to determine ligand specificity.

Assay TypeMethodologyAdvantagesLimitations
Calcium ImagingFluorescent calcium indicators in OR6S1-expressing cellsReal-time visualization, spatial resolutionIndirect measure of activation
cAMP AssayReal-time cAMP measurements using FRET-based sensorsHigh sensitivity, quantitativeRequires specialized reagents
Intrinsic Tryptophan FluorescenceMeasure changes in fluorescence upon ligand bindingDirect binding quantificationRequires purified protein
Surface Plasmon ResonanceMeasure direct binding kineticsProvides kon and koff ratesComplex immobilization of GPCRs
Computational DockingVirtual screening of compound librariesHigh throughput, structure-basedRequires structural information

What approaches should be used to determine the structural properties of OR6S1?

To determine the structural properties of OR6S1, combine complementary biophysical and computational approaches. For secondary structure analysis, employ circular dichroism spectroscopy on purified receptor samples to verify proper folding and estimate alpha-helical content, which should be approximately 50-60% for a typical olfactory receptor. For tertiary structure insights without crystallization, apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions and potentially identify the ligand-binding pocket. Cryo-electron microscopy represents the most promising approach for high-resolution structure determination, particularly if OR6S1 can be stabilized in an appropriate detergent or lipid nanodisc system. For computational structure prediction, leverage AlphaFold or RoseTTAFold algorithms, calibrated with experimental constraints from cross-linking mass spectrometry or evolutionary coupling analysis. Molecular dynamics simulations can further refine models and provide insights into receptor dynamics and conformational changes upon ligand binding.

How can OR6S1 expression patterns be integrated with clinical data for prognostic applications?

Analysis StepMethodologyKey Considerations
Signature DevelopmentPCA, NMF, or weighted gene co-expression network analysisBalance between signature complexity and interpretability
Patient StratificationHierarchical clustering or similarity-based groupingDetermine optimal number of patient subgroups
Survival AnalysisKaplan-Meier curves, log-rank tests, Cox modelsAccount for censored data and competing risks
Multivariate IntegrationPenalized regression methods, random forest modelsInclude established prognostic factors
Cross-Cohort ValidationMeta-analysis approaches, effect size combinationAddress batch effects between datasets

What are the most promising approaches for studying OR6S1's potential functions outside the olfactory system?

To investigate OR6S1's potential functions outside the olfactory system, implement a multi-faceted research strategy combining expression analysis, functional genomics, and physiological studies. Begin with comprehensive expression profiling across diverse tissue and cell types using RNA sequencing, prioritizing tissues with detectable OR6S1 expression for further investigation. Apply CRISPR-Cas9 gene editing to generate OR6S1 knockout models in relevant cell lines to assess phenotypic changes. Complement this with overexpression studies using inducible systems to identify potential gain-of-function effects. For mechanistic insights, employ phosphoproteomics and interactome analyses to map OR6S1 signaling networks in non-olfactory contexts. Additionally, develop tissue-specific conditional knockout mouse models to evaluate systemic physiological effects. This approach has revealed unexpected functions of other olfactory receptors in processes such as chemotaxis, metabolism, and tumor progression, suggesting OR6S1 may similarly participate in diverse biological processes beyond olfaction.

How can contradictions in OR6S1 data be leveraged for more robust research designs?

Contradictions in OR6S1 data should be viewed as opportunities to develop more nuanced research designs rather than obstacles to overcome. Start by mapping the specific nature of contradictions across studies, distinguishing between methodological discrepancies and potentially meaningful biological variance. Implement triangulation approaches that deliberately employ multiple complementary methods to address the same research question from different angles. For instance, combine bulk tissue transcriptomics, single-cell analysis, and protein-level detection to comprehensively characterize OR6S1 expression patterns. When designing experiments, build in explicit tests of competing hypotheses that could explain previous contradictory findings. Additionally, employ Bayesian analytical frameworks that can formally incorporate prior contradictory evidence rather than binary acceptance/rejection of hypotheses. This approach transforms data contradictions from liabilities into assets that drive more comprehensive understanding of complex biological systems like olfactory receptor function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.