Recombinant Human Olfactory receptor 7A10 (OR7A10)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Expression Systems

  • cDNA ORF clones: Available commercially (e.g., GenScript) for mammalian expression systems

  • Common hosts: HEK293, Hana3A cells for functional studies

Key Applications of Recombinant OR7A10

  1. Odorant Screening: Used in calcium imaging assays to identify activating ligands

  2. Antibody Development: Target for immunodetection tools (e.g., Western blot, ELISA)

  3. Structural Studies: Basis for homology modeling due to lack of resolved crystal structures

Research Findings & Functional Insights

Ligand Specificity

  • No physiological ligands confirmed

  • Suspected activation by hydrophobic compounds (Class II OR characteristic)

Role in Non-Olfactory Tissues

  • Detected in human spermatozoa, suggesting chemotactic roles in reproduction

  • Potential involvement in airway epithelial signaling

Pathophysiological Associations

  • Hypothesized link to neurodegenerative diseases via metalloprotein dysfunction

Future Directions

  1. Deorphanization Efforts: High-throughput screening to identify ligands

  2. Structural Biology: Cryo-EM studies to resolve activation mechanisms

  3. Therapeutic Exploration: Targeting OR7A10 for smell disorders or metabolic diseases

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
OR7A10; Olfactory receptor 7A10; OST027; Olfactory receptor OR19-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR7A10
Target Protein Sequence
MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAY DRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCE INQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA MKTFFRGKQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8356

KEGG: hsa:390892

STRING: 9606.ENSP00000248058

UniGene: Hs.553776

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR7A10 and what is its function?

OR7A10 (Olfactory receptor 7A10) is a protein encoded by the OR7A10 gene in humans. It functions as an olfactory receptor that interacts with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell. Like other olfactory receptors, OR7A10 is part of the mechanism that enables humans to detect and discriminate between thousands of different odors . The receptor works by recognizing specific odorant molecules, which leads to G protein-mediated signal transduction and ultimately to the perception of specific smells .

What protein family does OR7A10 belong to?

OR7A10 belongs to the large family of G-protein-coupled receptors (GPCRs). Specifically, it is a member of the olfactory receptor proteins, which are characterized by having seven transmembrane domains. These olfactory receptors share structural similarities with many neurotransmitter and hormone receptors . The olfactory receptor gene family to which OR7A10 belongs is notably the largest gene family in the human genome, highlighting its evolutionary significance in sensory perception .

What are the known aliases for OR7A10?

According to the available literature, OR7A10 is also known by several aliases:

  • Olfactory receptor OR19-18

  • BC85395_3

  • Olfactory receptor, family 7, subfamily A, member 10

  • OST027

These alternative designations may appear in different databases and research papers, which is important for researchers to recognize when conducting literature searches or database queries related to this receptor.

What is the basic structure of OR7A10?

OR7A10, like all olfactory receptors, possesses a characteristic 7-transmembrane domain structure that spans the cell membrane . This structure is typical of G-protein-coupled receptors and consists of seven α-helical segments that traverse the lipid bilayer of the cell membrane. The N-terminus of the protein is located extracellularly, while the C-terminus is intracellular. The transmembrane domains are connected by alternating extracellular and intracellular loops. The binding site for odorant molecules is believed to be formed by the transmembrane domains, creating a pocket where specific odorants can interact with the receptor .

What odorants are known to interact with OR7A10?

The identification of specific ligands for OR7A10 would typically involve screening a library of odorant molecules using functional assays that measure receptor activation, such as calcium imaging, cAMP assays, or luciferase reporter systems. The response patterns would then need to be analyzed at different concentrations to determine affinity and efficacy parameters.

How does OR7A10 contribute to the combinatorial olfactory code?

Olfactory perception operates on a combinatorial coding principle where individual odorants activate specific subsets of olfactory receptors, and each receptor can respond to multiple different molecules . The specific contribution of OR7A10 to this combinatorial code would depend on its response spectrum to various odorants.

According to the literature on olfactory coding: "a molecule can activate a subset of receptors and each receptor can respond to several different molecules" . This means OR7A10 likely recognizes a range of structurally related odorants with varying affinities, and these same odorants probably activate other olfactory receptors as well. The resulting activation pattern across all olfactory receptors forms a unique "fingerprint" for each odor.

Research has shown that "even minor alterations in the functionality of a single receptor can lead to notable perceptual consequences" , suggesting that understanding OR7A10's specific role in the combinatorial code could provide insights into particular olfactory perceptions.

What protein interactions have been documented for OR7A10?

Other potential interacting proteins might include receptor trafficking proteins that help transport the receptor to the cell membrane, and various components of the signaling cascade downstream of G protein activation. A comprehensive analysis of OR7A10's protein-protein interactions would require targeted proteomic studies or yeast two-hybrid screens.

How does OR7A10 activity vary with ligand concentration?

While the search results don't provide specific information about OR7A10's concentration-response characteristics, general principles applicable to olfactory receptors include:

"Olfactory perception is dependent on odorant concentration and changes in concentration can lead to different perception of hedonicity or olfactory quality. From a molecular point of view, concentration of a ligand has a considerable influence on the response of ORs. An increase in the ligand concentration results in a higher probability of OR activation, ultimately leading to an increase in cellular signaling. This way, a molecule will not induce any cellular response at low concentration, whereas it will become an agonist for a large subset of ORs when its concentration increases."

This suggests that OR7A10, like other olfactory receptors, would show concentration-dependent activation patterns. At low concentrations, only high-affinity ligands would activate the receptor, while at higher concentrations, a broader range of molecules might act as agonists. This property is crucial for understanding the receptor's physiological role and for designing experiments to characterize its ligand interactions.

How does the stereochemistry of odorants affect OR7A10 activation?

"A great deal of effort has been invested in providing stereochemistry of molecules. Indeed, certain ORs, such as OR1A1, have a different response to enantiomers, making the complete curation of stereochemistry an essential aspect."

While this example refers to OR1A1, it illustrates an important principle that may apply to OR7A10 as well. Enantiomers (mirror-image molecules) and other stereoisomers can have different binding affinities and efficacies at olfactory receptors, potentially resulting in different activation patterns and ultimately different odor perceptions. Investigating whether OR7A10 exhibits stereoselectivity would be an important aspect of characterizing its ligand recognition properties.

What expression systems are most effective for studying recombinant OR7A10?

The literature mentions a specific example: "new ligands for ORs were successfully identified in human prostate carcinoma cell lines (LNCaP), whereas they were not recognised when ORs were expressed in HEK293 cells."

Common expression systems for recombinant olfactory receptors include:

  • HEK293 cells (human embryonic kidney cells)

  • Hana3A cells (HEK293 cells stably expressing accessory factors)

  • Sf9 insect cells

  • Wheat germ cell-free expression systems (similar to what's used for OR10X1)

For OR7A10 specifically, researchers would need to evaluate multiple expression systems to determine which provides the most functional expression, potentially aided by receptor trafficking proteins and chaperones to improve cell surface expression.

What bioassays are recommended for measuring OR7A10 activation?

The search results don't specify bioassays for OR7A10 specifically, but they mention that the M2OR database includes information about experimental procedures and bioassays used to study olfactory receptors . Commonly used functional assays for olfactory receptors include:

  • Calcium imaging - Measures changes in intracellular calcium levels following receptor activation

  • cAMP assays - Measure changes in cAMP levels, as olfactory signal transduction typically involves adenylyl cyclase activation

  • Luciferase reporter assays - Use luciferase expression driven by cAMP-responsive elements to indirectly measure receptor activation

  • Electrophysiological recordings - Measure electrical responses in cells expressing the receptor

  • GTP-γS binding assays - Measure G protein activation directly

According to the literature, "it is crucial to take into consideration the instances of assay-dependent bias when interpreting OR responses" . Therefore, using multiple assay types would provide the most comprehensive characterization of OR7A10 activity.

How can researchers validate antibodies for OR7A10 studies?

When using antibodies for OR7A10 research, such as the polyclonal antibody mentioned in search result , proper validation is essential. Validation strategies should include:

  • Western blotting with positive controls (cells overexpressing OR7A10) and negative controls (non-transfected cells or cells expressing other olfactory receptors)

  • Immunocytochemistry to verify localization patterns consistent with olfactory receptors

  • Blocking peptide experiments to confirm specificity

  • Knockdown or knockout validation using siRNA or CRISPR techniques

  • Comparison of results from multiple antibodies targeting different epitopes of OR7A10

What computational approaches can predict OR7A10-odorant interactions?

While the search results don't specifically address computational methods for OR7A10, the M2OR database is mentioned as a resource that could potentially be used "to train a machine learning model" . Several computational approaches could be applied to predict OR7A10-odorant interactions:

  • Homology modeling - Building a 3D structural model of OR7A10 based on related GPCRs with known structures

  • Molecular docking - Virtual screening of potential ligands against the receptor model

  • Molecular dynamics simulations - Studying the dynamics of receptor-ligand interactions

  • Machine learning approaches - Training models on known olfactory receptor-odorant interactions to predict new ones

  • Pharmacophore modeling - Identifying chemical features important for receptor binding

These approaches would benefit from the curated data in the M2OR database, which contains information on "75,050 bioassay experiments for 51,395 distinct OR-molecule pairs" . Such a database could provide valuable training data for machine learning models aimed at predicting OR7A10 ligands.

What challenges exist in producing functional recombinant OR7A10?

While the search results don't detail specific challenges for OR7A10 production, olfactory receptors as a class are notoriously difficult to express in functional form in heterologous systems. Based on general knowledge about olfactory receptor expression, challenges likely include:

  • Poor trafficking to the cell membrane - ORs often fail to reach the cell surface and remain trapped in the endoplasmic reticulum

  • Improper folding - The complex 7-transmembrane structure can be difficult to fold correctly in non-native environments

  • Lack of accessory proteins - Olfactory neurons express various proteins that assist OR function that may be absent in heterologous systems

  • Low stability - ORs may be unstable in detergent solutions, complicating purification

  • Assay-dependent bias - As mentioned in the literature, different expression systems and assays can yield different results

To address these challenges, researchers often use specialized expression systems (like Hana3A cells), coexpress accessory factors (like RTP1, RTP2, and REEP1), use N-terminal tags to improve trafficking, and culture cells at lower temperatures to improve folding.

How is the M2OR database advancing OR7A10 research?

The M2OR database (Molecule to Olfactory Receptor) represents a significant advancement in olfactory receptor research by providing "the largest and most comprehensive database of OR-molecule experiments available" . While not specifically focused on OR7A10, this resource includes curated data on 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs, drawn from published literature and public databases .

For OR7A10 researchers, the database offers several advantages:

  • It includes information on concentration-dependence of receptor responses

  • It provides stereochemistry information for tested molecules

  • It includes metadata about experimental procedures and bioassay types

  • It contains information about both responsive and non-responsive OR-molecule pairs

These features allow researchers to analyze "OR-molecule interaction beyond simple responsiveness" , potentially offering insights into OR7A10's response profile and helping to design more informative experiments.

What is known about OR7A10's evolutionary conservation?

To investigate OR7A10's evolutionary conservation, researchers could:

  • Perform phylogenetic analyses comparing OR7A10 sequences across species

  • Identify orthologs in other mammals and vertebrates

  • Analyze selection pressures (Ka/Ks ratios) on the OR7A10 gene

  • Compare ligand specificity of OR7A10 orthologs across species

  • Investigate the presence of OR7A10 pseudogenes in different lineages

Such analyses could provide insights into the evolutionary significance of this particular receptor and its potential specialization for detecting specific ecologically relevant odorants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.