Recombinant Human Olfactory receptor 7A17 (OR7A17)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant OR7A17 is synthesized using Escherichia coli as the expression host. Key details include:

ProductSource/HostSpeciesTagLengthCatalog Number
Recombinant OR7A17 ProteinE. coliHumanHisFull-length (1-309)RFL34593HF

This system ensures high yield and purity, critical for functional studies .

Functional Insights

OR7A17 is implicated in calcium signaling and cellular proliferation, particularly in keratinocytes:

  • ATRA Interaction: All-trans retinoic acid (ATRA), a retinoid used in dermatology, suppresses OR7A17 expression via RARα/γ-mediated signaling, reducing keratinocyte proliferation .

  • Calcium Modulation: OR7A17 overexpression reverses ATRA-induced attenuation of Ca²⁺ influx, suggesting its role in maintaining calcium homeostasis .

  • Proliferation Effects: OR7A17 enhances HaCaT keratinocyte proliferation and counteracts ATRA’s antiproliferative effects .

Key Research Findings

Recent studies highlight OR7A17’s mechanistic roles:

ATRA-Induced Suppression (2021 Study)

  • Experimental Model: HaCaT keratinocytes transduced with lentiviral OR7A17 (LvCMV-OR7A17) .

  • Results:

    • ATRA reduced endogenous OR7A17 levels by 40–60% .

    • OR7A17 overexpression restored Ca²⁺ influx and proliferation in ATRA-treated cells .

    • Antagonists of RARα/γ (e.g., RO 41-5253, MM11253) reversed ATRA’s effects .

ParameterEffect of OR7A17 Overexpression
Proliferation (EdU assay)Increased by 1.8-fold vs. control
Ca²⁺ influxMaintained despite ATRA treatment

Potential Applications

Recombinant OR7A17 serves as a tool for:

  • Mechanistic Studies: Elucidating GPCR signaling in non-olfactory tissues.

  • Therapeutic Development: Targeting OR7A17 to mitigate ATRA’s adverse effects in dermatological treatments .

  • Calcium Signaling Research: Investigating TRPV1/TRPA1 channel interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR7A17; Olfactory receptor 7A17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR7A17
Target Protein Sequence
MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA LKMSFRGKQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8363

KEGG: hsa:26333

STRING: 9606.ENSP00000328144

UniGene: Hs.247717

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR7A17 and what is its biological function?

OR7A17 is a member of the olfactory receptor family, which constitutes the largest gene family in the human genome. As a G-protein-coupled receptor (GPCR), it features a characteristic 7-transmembrane domain structure that is shared with many neurotransmitter and hormone receptors. OR7A17 functions primarily in the olfactory system where it interacts with odorant molecules to initiate neuronal responses that trigger smell perception .

The receptor is encoded by a single coding-exon gene and is responsible for the recognition and G protein-mediated transduction of odorant signals. Like other ORs, OR7A17 participates in combinatorial odor detection, where each receptor can recognize multiple odorants, and conversely, individual odorants are detected by distinct combinations of receptors .

Beyond its canonical role in olfaction, OR7A17 has been identified in extra-nasal tissues, particularly in human keratinocytes (HaCaT cells), where it appears to influence cell proliferation through calcium signaling pathways .

How is OR7A17 classified within the olfactory receptor family?

OR7A17 belongs to subfamily 7A of the human olfactory receptor family. The classification system for olfactory receptors is based on sequence similarity, with members of the same subfamily sharing ≥60% amino acid sequence identity. This level of sequence similarity is functionally significant as receptors within the same subfamily tend to recognize structurally related odorants .

The human OR family comprises 172 distinct subfamilies distributed across 51 different loci on 21 chromosomes. Most subfamilies (79%) are encoded by genes at a single chromosomal locus, highlighting the important role of local gene duplication and divergence in OR family evolution. This genomic organization suggests that different chromosomal loci may be involved in the perception of different types of odors .

What experimental approaches are used to express recombinant OR7A17 for functional studies?

Recombinant expression of OR7A17 typically involves the following methodological approaches:

  • Vector selection: Most researchers use mammalian expression vectors (e.g., pcDNA3.1, pCMV) containing strong promoters like CMV for efficient expression.

  • Cell line selection: HEK293 cells are commonly employed due to their high transfection efficiency and minimal endogenous OR expression. For tissue-specific studies, relevant cell types such as HaCaT keratinocytes can be used .

  • Expression enhancement strategies: Several approaches can improve functional expression:

    • Coexpression with accessory proteins (e.g., RTP1S, RTP2, REEP1)

    • N-terminal fusion with rhodopsin or other well-expressed GPCR tags

    • Codon optimization for mammalian expression

    • Growth at reduced temperature (33°C) following transfection

  • Verification methods: Expression should be validated using:

    • Western blotting (if suitable antibodies are available)

    • qRT-PCR for mRNA levels

    • Immunofluorescence microscopy for cellular localization

    • Functional calcium imaging or cAMP assays

This systematic approach ensures reliable expression of functional OR7A17 for downstream applications and avoids common pitfalls in GPCR expression studies.

What are the key considerations for designing experiments to study OR7A17 function?

When designing experiments to investigate OR7A17 function, researchers should consider the following methodological elements:

  • Define research variables:

    • Independent variables: Potential ligand concentrations, expression levels of OR7A17, presence of signaling modulators

    • Dependent variables: Calcium influx, cAMP production, cell proliferation rates, downstream gene expression

    • Control variables: Cell passage number, transfection efficiency, cell density

  • Design appropriate controls:

    • Negative controls: Empty vector transfection, known non-ligands

    • Positive controls: Cells expressing well-characterized ORs with known ligands

    • Internal controls: Housekeeping gene expression, total protein normalization

  • Measurement approach: Select appropriate assays for GPCR activation:

    • Calcium imaging with fluorescent indicators (Fura-2, Fluo-4)

    • BRET/FRET-based sensors for conformational changes

    • cAMP accumulation assays

    • Receptor internalization studies

    • Electrophysiological recordings (in native tissues)

  • Statistical considerations:

    • Sample size determination through power analysis

    • Appropriate statistical tests based on data distribution

    • Controlling for multiple comparisons when screening multiple ligands

Following these structured experimental design principles allows for robust and reproducible investigation of OR7A17 function in various biological contexts.

How does OR7A17 expression influence keratinocyte proliferation and what are the underlying mechanisms?

OR7A17 expression in human keratinocytes (HaCaT cells) has been demonstrated to positively regulate cell proliferation through calcium signaling pathways. The relationship between OR7A17 and keratinocyte proliferation involves several interrelated mechanisms:

  • OR7A17 expression and ATRA response: All-trans retinoic acid (ATRA) treatment downregulates OR7A17 expression in keratinocytes. This downregulation is mediated through nuclear retinoic acid receptor (RAR) signaling, specifically via RAR α and RAR γ receptors. When RAR antagonists are applied, ATRA-induced downregulation of OR7A17 is attenuated, confirming the involvement of these receptors in the regulatory pathway .

  • Effect on calcium signaling: OR7A17 overexpression increases calcium influx in keratinocytes. Notably, this effect counteracts the ATRA-induced attenuation of Ca2+ entry, suggesting that OR7A17 modulates calcium homeostasis, which is critical for keratinocyte proliferation and differentiation .

  • Cellular proliferation outcomes: Experimental data demonstrates that:

    • OR7A17 overexpression enhances keratinocyte proliferation

    • This proliferative effect can offset the antiproliferative action of ATRA

    • The mechanism appears to be calcium-dependent

Table 1: Effects of OR7A17 manipulation on keratinocyte responses to ATRA

Experimental ConditionOR7A17 ExpressionCa2+ EntryCell Proliferation
ControlBaselineNormalNormal
ATRA treatmentDecreasedAttenuatedDecreased
OR7A17 overexpressionIncreasedEnhancedIncreased
ATRA + OR7A17 overexpressionMaintained elevatedPartially restoredPartially restored
RAR α/γ antagonist + ATRAMaintained near baselineLess attenuatedLess decreased

These findings suggest that OR7A17 may serve as a potential therapeutic target for mitigating the antiproliferative side effects of retinoid therapy while maintaining its beneficial aspects in dermatological conditions .

What approaches can be used to identify and validate natural ligands for OR7A17?

Identifying and validating natural ligands for OR7A17 requires a systematic, multi-faceted approach:

  • In silico prediction methods:

    • Homology modeling of OR7A17 based on related GPCR crystal structures

    • Virtual screening of chemical libraries using molecular docking

    • Analysis of subfamily relationships with ORs of known ligand specificity (OR7A17 belongs to subfamily 7A, and related ORs in the same subfamily likely recognize structurally similar odorants)

  • High-throughput screening approaches:

    • Calcium imaging-based screening with libraries of odorants

    • Reporter gene assays (e.g., luciferase under control of cAMP-responsive elements)

    • Membrane potential assays using voltage-sensitive dyes

    • Label-free technologies (surface plasmon resonance, biolayer interferometry)

  • Validation of candidate ligands:

    • Dose-response studies to determine EC50 values

    • Structure-activity relationship analyses with structural analogs

    • Competition binding assays with known ligands

    • Mutational analysis of predicted binding pocket residues

    • Confirmation in different cell types expressing OR7A17

  • Functional confirmation in physiological contexts:

    • Ex vivo studies in native tissues expressing OR7A17

    • Analysis of downstream signaling cascade activation

    • Evaluation of biological responses (e.g., proliferation in keratinocytes)

This comprehensive approach integrates computational prediction with experimental validation to reliably identify physiologically relevant ligands for OR7A17. The combinatorial nature of olfactory coding suggests that OR7A17 likely responds to multiple structurally related compounds, necessitating thorough characterization of its ligand recognition profile .

What are the challenges in developing specific antibodies against OR7A17 and how can they be overcome?

Developing specific antibodies against OR7A17 presents several challenges that are common to many GPCRs, but can be addressed through strategic approaches:

  • Key challenges:

    • High sequence similarity among OR family members (particularly within subfamily 7A)

    • Multiple hydrophobic transmembrane domains that are poorly immunogenic

    • Limited availability of native protein for immunization

    • Potential conformational epitopes lost during sample preparation

    • Low expression levels in native tissues

  • Strategic antigen design:

    • Target unique extracellular loops (ECLs) or N-terminal regions that distinguish OR7A17 from related ORs

    • Use synthetic peptides corresponding to unique sequences within OR7A17

    • Consider recombinant expression of soluble domains fused to carrier proteins

    • Employ whole cell immunization with cells overexpressing OR7A17

  • Advanced antibody generation technologies:

    • Phage display selection against specific OR7A17 domains

    • Single B-cell cloning from immunized animals

    • Nanobody development (single-domain antibodies with enhanced access to GPCR epitopes)

    • Hybridoma screening with both positive (OR7A17-expressing) and negative (related OR-expressing) cells to ensure specificity

  • Rigorous validation protocols:

    • Western blotting with positive controls (recombinant OR7A17) and negative controls (related ORs)

    • Immunoprecipitation followed by mass spectrometry

    • RNA interference to confirm signal reduction upon OR7A17 knockdown

    • Immunohistochemistry in tissues with known OR7A17 expression patterns

    • Absence of signal in OR7A17 knockout models (if available)

By implementing these strategies, researchers can develop and validate antibodies with sufficient specificity and sensitivity for OR7A17 detection, enabling more detailed studies of its expression, localization, and function across different tissues and conditions.

How can CRISPR/Cas9 gene editing be optimized for studying OR7A17 function?

Optimizing CRISPR/Cas9 gene editing for OR7A17 functional studies requires attention to several methodological considerations:

  • Guide RNA (gRNA) design strategy:

    • Target unique sequences within OR7A17 to avoid off-target effects on related ORs

    • Use multiple prediction algorithms to identify optimal gRNA sequences with high on-target and low off-target scores

    • Consider targeting:

      • The coding region for complete knockout

      • The promoter region for expression modulation

      • Specific domains for structure-function studies

  • Delivery and expression system optimization:

    • For keratinocytes and olfactory cells:

      • Nucleofection often yields higher efficiency than lipid-based transfection

      • Lentiviral delivery for difficult-to-transfect primary cells

      • Consider using Cas9 variants (e.g., high-fidelity Cas9) to minimize off-target effects

    • Transient vs. stable Cas9 expression based on experimental needs

  • Verification strategies for editing efficiency:

    • T7 Endonuclease I assay or Surveyor assay for initial detection of indels

    • Next-generation sequencing to quantify editing efficiency and characterize modifications

    • Western blotting and qRT-PCR to confirm protein and mRNA level changes

    • Off-target analysis through whole-genome sequencing or targeted sequencing of predicted sites

  • Functional validation approaches:

    • Calcium imaging to assess changes in ligand responsiveness

    • Proliferation assays in keratinocyte models

    • Rescue experiments with wild-type OR7A17 to confirm phenotype specificity

    • Comparative analysis with pharmacological inhibition approaches

Table 2: CRISPR/Cas9 experimental design considerations for OR7A17 studies

Experimental GoalTarget RegionCell ModelDelivery MethodValidation Approach
Complete knockoutEarly exonHaCaT cellsNucleofectionWestern blot, proliferation assay
Expression modulationPromoter regionHEK293 + OR7A17LipofectionqRT-PCR, calcium imaging
Domain modificationSpecific TM regionsPrimary keratinocytesLentiviralLigand binding, signaling assay
Reporter knock-inC-terminusOlfactory cell lineElectroporationFluorescence, localization study

By implementing these optimized CRISPR/Cas9 approaches, researchers can effectively manipulate OR7A17 expression and structure to elucidate its functional roles in olfaction and extrasensory tissues.

How do polymorphisms in OR7A17 correlate with individual variations in odorant perception and potential extrasensory functions?

The investigation of OR7A17 polymorphisms and their functional consequences requires a comprehensive approach encompassing genomics, functional characterization, and phenotypic correlation:

  • Identification of OR7A17 polymorphisms:

    • Analysis of population genomics databases (1000 Genomes, gnomAD)

    • Targeted sequencing of OR7A17 in diverse populations

    • Classification of variants:

      • Coding variants (missense, nonsense, frameshift)

      • Regulatory variants (promoter, splicing)

      • Copy number variations

  • Functional characterization of variant receptors:

    • Heterologous expression of variant OR7A17 alleles in cell models

    • Comparative ligand response profiles using:

      • Dose-response calcium imaging

      • cAMP accumulation assays

      • Receptor trafficking and surface expression analysis

    • Structural modeling to predict the impact of amino acid substitutions on ligand binding or G-protein coupling

  • Correlation with sensory phenotypes:

    • Psychophysical testing of odorant detection thresholds for predicted OR7A17 ligands

    • Odor discrimination and perception quality assessments

    • Meta-analysis of existing genome-wide association studies on olfactory perception

  • Investigation of extrasensory phenotypic correlations:

    • Association studies with skin conditions where keratinocyte proliferation is implicated

    • Response to retinoid therapy in dermatological patients

    • Analysis of calcium signaling in primary cells from individuals with different OR7A17 variants

Table 3: Representative OR7A17 polymorphisms and potential functional impacts

Variant TypeExample VariantPopulation FrequencyPredicted ImpactExperimental Evidence
Missensep.Arg235Cys2.3% in East AsianAltered ligand bindingReduced response to ligand X
Regulatoryc.-42T>C4.7% in EuropeanDecreased expression40% lower mRNA in keratinocytes
Nonsensep.Trp180*Rare (<0.1%)Loss of functionNo detectable signaling
Copy numberDuplicationVariablePotential gain of functionEnhanced calcium signaling

Note: The specific variants listed are hypothetical examples for illustrative purposes.

This multi-level approach enables the establishment of genotype-phenotype correlations for OR7A17 variants, potentially explaining individual differences in both olfactory perception and extrasensory functions such as keratinocyte responses to retinoids.

What are the most promising therapeutic applications of OR7A17 research?

Based on current understanding of OR7A17 function, several promising therapeutic applications warrant further investigation:

  • Dermatological applications:

    • Development of OR7A17 agonists to counteract the antiproliferative side effects of retinoid therapy while maintaining therapeutic benefits

    • Potential treatments for conditions characterized by impaired keratinocyte proliferation (e.g., chronic wounds, aging skin)

    • Topical formulations targeting OR7A17 to modulate calcium signaling in the epidermis

  • Olfactory disorders:

    • Targeted therapies for specific anosmias involving OR7A17 ligand detection pathways

    • Olfactory training protocols using known OR7A17 ligands for rehabilitating olfactory function

    • Biomarkers for predicting treatment responses in olfactory dysfunction

  • Beyond current applications:

    • Investigation of OR7A17 expression and function in other tissues where ectopic olfactory receptors have been identified

    • Exploration of OR7A17's potential role in cellular homeostasis beyond currently known functions

    • Development of OR7A17-based biosensors for detecting specific compounds in environmental or biological samples

Future therapeutic development will depend on more comprehensive characterization of OR7A17's ligand profile, signaling pathways, and tissue-specific functions, as well as validation in appropriate preclinical models before clinical translation.

What critical gaps remain in our understanding of OR7A17 biology?

Despite progress in OR7A17 research, several critical knowledge gaps remain that should guide future research efforts:

  • Molecular characterization:

    • Identification of the complete spectrum of natural ligands for OR7A17

    • Determination of the three-dimensional structure of OR7A17

    • Characterization of OR7A17's G-protein coupling preferences and downstream signaling pathways in different cell types

    • Understanding the mechanisms of OR7A17 regulation beyond retinoid-mediated effects

  • Physiological roles:

    • Comprehensive mapping of OR7A17 expression across human tissues

    • Elucidation of its specific contribution to olfactory coding among the family of olfactory receptors

    • Investigation of potential developmental roles during epithelial differentiation

    • Understanding evolutionary conservation and divergence of OR7A17 function

  • Clinical correlations:

    • Association between OR7A17 variants and susceptibility to skin conditions

    • Role in the pathogenesis of proliferative skin disorders

    • Correlation between OR7A17 function and response to dermatological treatments

    • Potential involvement in other calcium-dependent cellular processes in health and disease

Addressing these knowledge gaps will require interdisciplinary approaches combining molecular biology, structural biology, genetics, physiology, and clinical research to fully understand the multifaceted biology of OR7A17 and harness its potential for therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.