Recombinant Human Olfactory receptor 7A5 (OR7A5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR7A5; Olfactory receptor 7A5; Olfactory receptor OR19-17; Olfactory receptor TPCR92
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR7A5
Target Protein Sequence
MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAY DRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCE LNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFST CASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRA LGIHLLWGTMKGQFFKKCP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8368

KEGG: hsa:26659

STRING: 9606.ENSP00000316955

UniGene: Hs.137573

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR7A5 and where is it primarily expressed?

OR7A5 is a member of the olfactory receptor family 7 subfamily A, which belongs to the G protein-coupled receptor (GPCR) superfamily. While originally identified in olfactory epithelium, OR7A5 demonstrates significant expression in human reproductive tissues, particularly in spermatozoa and testis. Expression data indicates levels of up to 2.61 FPKM in testis and up to 0.3 FPKM in mature spermatozoa . Beyond reproductive tissues, recent research has identified notable OR7A5 expression in certain tumor types, establishing it as a protein of interest in diverse physiological and pathological contexts .

How does OR7A5 fit within the human olfactory receptor family classification?

OR7A5 belongs to subfamily 7A within the human olfactory receptor gene family. The human OR family operates through combinatorial odor detection, with each receptor recognizing multiple odorants and different odorants being detected by distinct combinations of receptors . ORs within the same subfamily typically recognize odorants with similar structural features, suggesting that subfamily 7A may be specialized for detecting particular chemical structures . The genomic organization of OR genes reveals that most subfamily members are encoded by genes located at a single chromosomal locus, highlighting the role of local gene duplication in OR evolution .

What is the known ligand for OR7A5?

Research has identified 4-hydroxy-2,5-dimethyl-3(2H)-furanone as a naturally occurring ligand that activates OR7A5 . This finding is significant as it establishes OR7A5 as a functionally active receptor outside the olfactory system. The activation of OR7A5 by this compound has been linked to chemokinetic functions in human spermatozoa, suggesting a role in sperm motility and function . Understanding ligand specificity is crucial for developing experimental models that accurately recapitulate OR7A5 activation in various tissues.

How can researchers accurately measure OR7A5 expression at the transcript level?

To quantify OR7A5 transcript levels, RNA-Seq represents the gold standard approach. This methodology has successfully identified both sense and antisense transcripts of OR7A5 in human spermatozoa and testis . When designing RNA-Seq experiments for OR7A5:

  • Consider strand-specific sequencing to differentiate between sense and antisense transcripts

  • Include appropriate reference tissues where OR7A5 expression is expected to be minimal

  • Use FPKM (Fragments Per Kilobase Million) or TPM (Transcripts Per Million) for normalized expression quantification

  • Validate RNA-Seq findings with quantitative PCR using primers specific to the OR7A5 transcript

For researchers investigating OR7A5 expression in cancer, reference databases like TCGA, GEO, and GTEx provide valuable comparative expression data across multiple tissue and tumor types .

What approaches are recommended for OR7A5 protein detection and localization?

Detecting OR7A5 protein presents several challenges common to GPCR research. Based on published methodologies:

  • Immunocytochemistry/Immunohistochemistry: Use validated antibodies against OR7A5, with appropriate controls including peptide competition assays and recombinant expression systems

  • Western Blotting: Optimize protein extraction protocols for membrane proteins, potentially using specialized detergents like CHAPS or DDM

  • Recombinant Expression Systems: For functional studies, express OR7A5 in heterologous systems such as Hana3A cells, which have been successfully used for OR functional characterization

A critical consideration is the potential discrepancy between transcript and protein levels. Research has demonstrated that high transcript abundance does not necessarily correlate with robust protein expression for olfactory receptors .

What is the functional significance of OR7A5 in human spermatozoa?

OR7A5 has been implicated in sperm chemotaxis and motility regulation. The activation of OR7A5 by its ligand (4-hydroxy-2,5-dimethyl-3(2H)-furanone) is linked to a chemokinetic function in human spermatozoa . The signaling mechanism appears to be distinct from classical olfactory signaling:

  • OR7A5-mediated signaling in sperm is independent of adenylyl cyclase activation and second messengers (cAMP and cGMP)

  • The response strongly depends on calcium channels, suggesting involvement of alternative signaling pathways

Understanding this non-canonical signaling mechanism provides insight into specialized functions of ORs outside the olfactory system and highlights potential targets for modulating sperm function.

How does calcium signaling relate to OR7A5 function in spermatozoa?

The calcium signaling pathway appears central to OR7A5 function in spermatozoa. Research indicates that odorant-induced calcium signals in human sperm strongly depend on extracellular calcium entering the cell via calcium-permeable channels . Experimental evidence suggests:

  • Mibefradil, which inhibits calcium channels including CatSper and CACNA1H, blocks calcium signals induced by most odorants

  • Some odorants may directly activate the CatSper channel, while others may trigger signaling cascades by activating ORs

  • Alternative mechanisms might involve direct OR-triggered G protein activation of calcium channels or G-protein independent mechanisms such as Src kinase activation

For researching OR7A5-mediated calcium signaling, recommended approaches include calcium imaging using fluorescent indicators and patch-clamp electrophysiology with specific channel blockers.

What evidence supports OR7A5 as a potential biomarker in cancer?

Recent pan-cancer analysis has identified OR7A5 as a potential biomarker in several tumor types. Key findings include:

  • Heightened OR7A5 expression in certain tumors compared to normal tissues

  • Correlation between OR7A5 expression levels and immune checkpoint expression

  • Association with immune cell infiltration in the tumor microenvironment

Of particular significance is the role of OR7A5 in gliomas, where expression levels correlate with:

  • Adverse prognosis

  • 1p/19q co-deletion status

  • Wild-type IDH status

These correlations suggest utility as a prognostic biomarker in glioma stratification and potentially other cancer types.

What methodological approaches can be used to study OR7A5 function in cancer cells?

To investigate OR7A5 functions in cancer biology, researchers should consider:

For expression manipulation:

  • RNA interference (siRNA, shRNA) for OR7A5 knockdown

  • CRISPR-Cas9 for OR7A5 knockout

  • Overexpression systems using recombinant OR7A5

For functional assessment:

  • Proliferation assays (MTT, BrdU incorporation, colony formation)

  • Migration and invasion assays

  • Metabolic analyses, particularly focused on lipid metabolism

  • Signaling pathway analysis, including calcium signaling and potential downstream effectors

In vitro experiments have demonstrated that OR7A5 knockdown inhibits the proliferative capacity of glioma cells and affects expression of proteins related to lipid metabolism, suggesting involvement in cancer cell metabolic reprogramming .

How can researchers investigate the relationship between OR7A5 and immune responses in cancer?

To explore the reported correlation between OR7A5 expression and immune parameters:

  • Bioinformatic approaches:

    • Analyze public datasets (TCGA, GEO) for correlations between OR7A5 expression and immune cell markers

    • Use platforms like TIMER2 and TISDB to assess immune infiltration patterns

  • Experimental approaches:

    • Co-culture systems with immune cells and cancer cells with modulated OR7A5 expression

    • Flow cytometry analysis of tumor-infiltrating immune cells in models with varied OR7A5 expression

    • Cytokine profiling to assess immune response modulation

Understanding this relationship could provide insight into OR7A5's potential role in tumor-immune interactions and inform immunotherapy strategies.

What heterologous expression systems are optimal for recombinant OR7A5 studies?

For functional characterization of OR7A5, several expression systems have proven effective:

  • Hana3A cells: This system has been successfully used for deorphanization studies of several ORs including OR7A5 . These cells are derived from HEK293 cells and stably express accessory factors that enhance OR surface expression.

  • Recombinant expression protocol:

    • Amplify the complete OR7A5 open reading frame from human genomic DNA using PCR with specific primers

    • Include appropriate restriction sites (e.g., EcoRI, NotI, ApaI) for subcloning

    • Consider including an N-terminal tag (e.g., rhodopsin tag) to improve surface expression

    • Verify constructs by Sanger sequencing before transfection

  • Transfection method:

    • Standard calcium phosphate precipitation technique has been effective (0.5 μg plasmid DNA for 48 hours)

    • Alternative methods include lipid-based transfection or electroporation depending on cell type

For validation, Western blotting and immunofluorescence should be performed to confirm expression and appropriate localization.

How can researchers effectively design calcium imaging experiments to study OR7A5 activation?

Calcium imaging represents a key methodology for assessing OR7A5 function. Based on established protocols:

  • Experimental setup:

    • Transfect cells with OR7A5 expression construct

    • Include appropriate controls (mock-transfected, empty vector)

    • Load cells with calcium-sensitive dyes (e.g., Fura-2 AM)

    • Apply potential ligands while monitoring fluorescence changes

  • Critical parameters:

    • Calcium source (extracellular vs. intracellular)

    • Channel blockers to determine pathway specificity (e.g., mibefradil for CatSper)

    • Dose-response relationships to determine sensitivity

    • Time course of calcium responses

  • Data analysis:

    • Normalize responses to baseline fluorescence

    • Compare response amplitudes and kinetics between conditions

    • Establish appropriate statistical tests for significance

Understanding the calcium signaling pathway activated by OR7A5 provides crucial insights into its functional mechanisms in different cellular contexts.

How do antisense transcripts influence OR7A5 expression and function?

The detection of antisense transcripts for OR7A5 raises important questions about regulatory mechanisms. Research has identified both sense and antisense transcripts for OR7A5 in human spermatozoa and testis . For investigating this phenomenon:

  • Characterization approaches:

    • Strand-specific RNA-Seq to accurately quantify sense vs. antisense transcripts

    • RACE (Rapid Amplification of cDNA Ends) to determine full transcript structures

    • Northern blotting to confirm transcript sizes

  • Functional analysis:

    • Antisense oligonucleotide targeting to manipulate antisense transcript levels

    • Assessment of sense transcript levels and protein expression following antisense manipulation

    • Investigation of potential regulatory roles in early embryogenesis

Antisense transcripts may function as regulatory elements involved in transcription modulation, RNA hybridization, or chromatin modification, suggesting complex regulatory mechanisms for OR7A5 expression .

What are the molecular mechanisms linking OR7A5 to lipid metabolism in cancer cells?

Recent research has identified a connection between OR7A5 and lipid metabolism in glioma cells . This unexpected finding warrants deeper investigation:

  • Experimental approaches:

    • Lipidomic analysis in cells with modulated OR7A5 expression

    • Metabolic flux analysis using isotope-labeled lipid precursors

    • Expression profiling of key lipid metabolism enzymes

    • Assessment of lipid droplet formation and fatty acid oxidation rates

  • Potential mechanisms:

    • Direct interaction with lipid metabolic enzymes

    • Signaling cascades affecting transcriptional regulators of metabolism

    • Altered calcium signaling affecting metabolic pathways

    • Changes in membrane lipid composition affecting receptor signaling

Understanding this connection could reveal novel therapeutic approaches targeting metabolic vulnerabilities in cancers expressing high levels of OR7A5.

What are the most promising translational applications for OR7A5 research?

Based on current knowledge, several translational pathways merit further investigation:

  • Reproductive medicine:

    • Development of diagnostic tools for male infertility based on OR7A5 function

    • Design of compounds targeting OR7A5 for potential contraceptive applications

    • Creation of media supplements containing OR7A5 ligands to enhance sperm function in assisted reproduction

  • Cancer therapeutics:

    • Validation of OR7A5 as a prognostic biomarker in gliomas and other cancers

    • Development of targeted therapies against OR7A5 or its downstream pathways

    • Exploration of OR7A5 expression as a stratification factor for existing therapies

  • Drug screening platforms:

    • Development of high-throughput assays for identifying novel OR7A5 modulators

    • Cell-based reporter systems for OR7A5 activation

    • In silico modeling of ligand binding to guide compound design

What technical challenges require resolution for advanced OR7A5 research?

Several technical limitations currently constrain OR7A5 research progress:

  • Structural biology challenges:

    • Limited availability of OR crystal structures or reliable structural models

    • Difficulties in producing sufficient quantities of purified receptor for structural studies

    • Technical issues in capturing different conformational states

  • Signaling pathway elucidation:

    • Incomplete understanding of non-canonical signaling mechanisms in different tissues

    • Difficulties in specific pathway isolation due to crosstalk

    • Need for more sensitive tools to detect transient signaling events

  • In vivo functional assessment:

    • Development of appropriate animal models that recapitulate human OR7A5 function

    • Design of tissue-specific conditional expression systems

    • Implementation of advanced imaging techniques for real-time monitoring of OR7A5 activity

Addressing these challenges will require interdisciplinary approaches combining molecular biology, structural biology, bioinformatics, and advanced imaging technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.