Recombinant Human Olfactory receptor 7C1 (OR7C1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant OR7C1 is typically expressed in mammalian systems (e.g., HEK293 cells) or bacterial hosts to ensure proper folding and post-translational modifications. Commercial preparations include:

Functional Insights

OR7C1 is implicated in both olfaction and non-olfactory roles, particularly in cancer biology:

Role in Cancer Stem Cells (CSCs)

  • Oral cancer: OR7C1 is selectively expressed in CD44+ oral CSCs, contributing to self-renewal and tumorigenicity. Knockdown via siRNA reduces sphere formation (a CSC marker) by 60–70% .

  • Immunotherapy target: HLA-A24-restricted OR7C1 peptides (e.g., TYAGCLSQIF) elicit cytotoxic T lymphocyte (CTL) responses, lysing OR7C1+ oral cancer cells .

Key Research Findings

Study FocusOutcomeSource
OR7C1 expressionExclusive to CSCs in oral squamous cell carcinoma
CTL responseOR7C1-specific CTLs lyse 80% of HLA-A24+/OR7C1+ cells in vitro
Gene silencingsiRNA reduces stemness markers (SOX2, NANOG) by 50%

4.1. Mechanistic Studies

Recombinant OR7C1 facilitates:

  • Ligand-receptor interaction assays: Identifying odorants or synthetic agonists/antagonists.

  • Signal transduction analysis: Mapping cAMP or calcium flux pathways .

4.2. Therapeutic Development

  • Cancer vaccines: OR7C1-derived peptides are candidates for CSC-targeted immunotherapy .

  • Drug discovery: High-throughput screening for OR7C1 modulators in neurodegenerative or metabolic diseases .

Future Directions

  • Structural resolution: Despite advances, OR7C1’s 3D structure remains uncharacterized, limiting ligand-design efforts .

  • Clinical trials: Testing OR7C1 peptide vaccines in oral cancer patients to validate preclinical efficacy .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery information.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR7C1; OR7C4; Olfactory receptor 7C1; Olfactory receptor 7C4; Olfactory receptor OR19-16; Olfactory receptor TPCR86
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR7C1
Target Protein Sequence
METGNQTHAQEFLLLGFSATSEIQFILFGLFLSMYLVTFTGNLLIILAICSDSHLHTPMY FFLSNLSFADLCFTSTTVPKMLLNILTQNKFITYAGCLSQIFFFTSFGCLDNLLLTVMAY DRFVAVCHPLHYTVIMNPQLCGLLVLGSWCISVMGSLLETLTVLRLSFCTEMEIPHFFCD LLEVLKLACSDTFINNVVIYFATGVLGVISFTGIFFSYYKIVFSILRISSAGRKHKAFST CGSHLSVVTLFYGTGFGVYLSSAATPSSRTSLVASVMYTMVTPMLNPFIYSLRNTDMKRA LGRLLSRATFFNGDITAGLS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8373

KEGG: hsa:26664

STRING: 9606.ENSP00000248073

UniGene: Hs.466053

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and classification of the human OR7C1 receptor?

OR7C1 is a seven-transmembrane G-protein-coupled olfactory receptor belonging to the Class O2 (tetrapod specific odorant) receptor family. Specifically, it is part of the Odorant family 7. It is also known by alternative names including Olfactory receptor 7C4, Olfactory receptor OR19-16, and Olfactory receptor TPCR86 . Like other olfactory receptors, OR7C1 has the characteristic structure of GPCRs with seven transmembrane domains connected by intracellular and extracellular loops. The receptor consists of 311 amino acids with specific structural regions including N-terminal domain, transmembrane helices (TM1-TM7), intracellular loops (ICL1-3), extracellular loops (ECL1-3), and a C-terminal helix (H8) . This structure is crucial for its function in ligand binding and signal transduction.

What expression patterns of OR7C1 have been observed in human tissues?

While OR7C1 was initially identified in olfactory epithelium, significant research has demonstrated its expression in multiple non-olfactory tissues. Data from The Cancer Genome Atlas (TCGA) and Genotype-Tissue Expression (GTEx) databases reveal variable expression levels across normal and cancerous tissues . Of particular interest is its notable expression in oral squamous cell carcinoma (OSCC), where approximately 61.5% of cases showed high levels of OR7C1 expression as confirmed by immunohistochemistry staining . This finding was consistent with TCGA database analysis showing elevated expression in 57.5% of cases. The receptor has also been identified as a marker in colon cancer initiating cells, suggesting a broader role beyond olfaction .

How does OR7C1 compare to other human olfactory receptors in terms of functional characterization?

Despite the human genome containing approximately 400 intact olfactory receptor genes, only about 10% have published ligands or established functions . OR7C1 represents one of many olfactory receptors that remain inadequately characterized in terms of specific ligand binding profiles and downstream signaling effects. The challenge in characterizing OR7C1 and other olfactory receptors stems from the vast search space covering interactions between hundreds of receptors and billions of odorous molecules . Current research is addressing this gap through high-throughput screening methodologies that test multiple receptors against panels of odorants simultaneously, helping to place OR7C1 within the broader context of olfactory receptor function.

What are the most effective heterologous expression systems for studying OR7C1 function?

Heterologous expression systems are essential for studying OR7C1 function due to the challenges in working directly with olfactory neurons. The most effective approach involves:

  • Cell Line Selection: Hana3A cells have proven particularly effective for OR7C1 studies. These cells are derived from HEK293T cells and have been engineered to stably express RTP1S and Gαolf, factors that enhance olfactory receptor trafficking to the cell membrane .

  • Co-transfection Components: For optimal expression, experiments should include:

    • 5 ng/well of RTP1S to enhance receptor trafficking

    • 5 ng/well of pRL-SV40 as a transfection control

    • 10 ng/well of CRE-luciferase as a reporter

    • 2.5 ng/well of M3 receptor to enhance coupling

    • 5 ng/well of the OR7C1 construct

  • Signal Amplification: The TAR-Tat system has demonstrated significant improvements in functional expression of olfactory receptors by enhancing transcription efficiency through positive feedback mechanisms . This system is particularly valuable for receptors like OR7C1 that may be poorly expressed on the cell surface of heterologous cells.

What functional assays are recommended for measuring OR7C1 activation responses?

The Dual-Glo Luciferase Assay System has emerged as the gold standard for measuring OR7C1 activation due to its sensitivity and reliability. The methodology involves:

  • Transfection Setup: Transfect Hana3A cells with OR7C1 along with accessory factors as detailed in section 2.1.

  • Ligand Exposure Protocol:

    • Remove transfection media 24 hours post-transfection

    • Replace with appropriate concentration of potential ligands diluted in CD293 media

    • Maintain cells with ligand exposure for 4 hours

  • Response Measurement:

    • Measure luminescence using a plate reader (e.g., Polarstar Optima)

    • Normalize all luminescence values by dividing by Renilla Luciferase activity to control for transfection efficiency

    • Analyze data using appropriate software (Excel, GraphPad Prism, or MATLAB)

  • Dose-Response Analysis: Generate dose-response curves by testing ligands at multiple concentrations (typically 10^-9 to 10^-3 M) to determine EC50 values and efficacy parameters.

How can researchers address the challenges of poor membrane localization when studying OR7C1?

Poor membrane localization represents one of the principal challenges in OR7C1 research. Several strategies can effectively address this issue:

  • Accessory Protein Co-expression: RTP1S (Receptor Transporting Protein 1 Short) significantly enhances trafficking of OR7C1 to the plasma membrane. Co-transfection with 5 ng/well of RTP1S has been demonstrated to improve functional expression .

  • Transcriptional Enhancement: The TAR-Tat system provides a positive feedback mechanism that increases transcription efficiency, resulting in improved cell surface expression. This approach focuses on increasing the total receptor production rather than just trafficking, addressing the expression problem from multiple angles .

  • Protein Engineering Approaches:

    • N-terminal fusion with rhodopsin or other well-expressed GPCR tags

    • Codon optimization for the expression system being used

    • Introduction of specific mutations in the receptor sequence to improve folding and trafficking

  • Culture Condition Optimization: Growing transfected cells at lower temperatures (30-32°C instead of 37°C) for 24-48 hours post-transfection can improve folding and trafficking of the receptor.

What is the current evidence for OR7C1 as a biomarker in cancer research?

Emerging evidence supports OR7C1 as a potentially valuable biomarker in cancer research:

How might OR7C1-targeted therapies be developed and what methodological approaches would be most promising?

Development of OR7C1-targeted therapies represents an emerging frontier with several methodological approaches showing promise:

  • Cancer Stem Cell-Targeted Immunotherapy:

    • Identification of OR7C1-specific peptides presented by HLA-A24

    • Development of T-cell based therapies targeting these peptides

    • Generation of specific antibodies or antibody-drug conjugates targeting extracellular domains of OR7C1

  • Small Molecule Modulator Development Pipeline:

    • Screening libraries of compounds against OR7C1 using the luciferase reporter system

    • Structure-activity relationship studies to optimize lead compounds

    • Development of antagonists (rather than agonists) may be more therapeutically relevant if OR7C1 signaling promotes cancer progression

  • Gene Therapy Approaches:

    • siRNA or shRNA targeting OR7C1 expression

    • CRISPR-Cas9 mediated knockout or modification

    • Viral vector delivery systems for targeted modification of OR7C1 in tumor cells

  • Combination Therapy Strategies:

    • Integration of OR7C1-targeted approaches with conventional chemotherapy

    • Dual targeting of OR7C1 and related signaling pathways

    • Use of OR7C1 as a biomarker for patient stratification in clinical trials

How can researchers address the high variability in functional responses when working with OR7C1?

The inherent variability in OR7C1 functional responses presents significant challenges for reliable interpretation. Researchers can implement several methodological approaches to mitigate this variability:

  • Standardized Positive Controls:

    • Include well-characterized olfactory receptors with known ligands as positive controls in every experiment

    • Normalize OR7C1 responses to these positive controls to account for day-to-day variability

  • Statistical Robustness:

    • Increase biological replicates (minimum n=5) across multiple independent transfections

    • Implement more sophisticated statistical methods beyond simple t-tests, such as ANOVA with post-hoc tests

    • Consider non-parametric statistics when appropriate for data that doesn't follow normal distribution

  • Advanced Normalization Techniques:

    • Implement multivariate normalization that accounts for transfection efficiency, cell density, and receptor expression levels

    • Quantify actual receptor expression levels through complementary techniques like flow cytometry or Western blotting

  • Data Visualization and Transparency:

    • Present complete datasets including non-responders and outliers

    • Use visualization methods that show data distribution (violin plots, box plots) rather than just means and standard errors

    • Report EC50 values along with 95% confidence intervals rather than single point estimates

What are the best practices for identifying and validating OR7C1 ligands through high-throughput screening?

High-throughput screening for OR7C1 ligands requires rigorous methodology to minimize false positives and negatives:

  • Initial Screening Protocol:

    • Screen compounds at multiple concentrations (typically 10-100 μM) rather than single concentrations

    • Include multiple negative controls (untransfected cells, cells expressing other receptors)

    • Test compounds in triplicate within the same experiment

  • Hit Confirmation Strategy:

    • Re-test initial hits in independent experiments

    • Generate full dose-response curves (10^-9 to 10^-3 M) for confirmed hits

    • Calculate Z-factors for the assay to ensure adequate separation between positive and negative controls

  • Orthogonal Validation Approaches:

    • Confirm responses using an alternative assay system (calcium imaging, cAMP accumulation, etc.)

    • Test structurally related compounds to establish structure-activity relationships

    • Verify specificity by testing hits against a panel of related olfactory receptors

  • Computational Validation:

    • Employ molecular docking to predict binding modes of potential ligands

    • Use machine learning algorithms to identify patterns in active compounds

    • Develop quantitative structure-activity relationship (QSAR) models to predict new potential ligands

How can researchers integrate OR7C1 functional data with structural biology insights for more comprehensive understanding?

Despite the challenges in obtaining crystal structures of OR7C1, several approaches can integrate functional data with structural insights:

  • Homology Modeling Approaches:

    • Develop homology models based on related GPCRs with solved crystal structures

    • Refine models using the known amino acid sequence of OR7C1

    • Validate models through mutagenesis experiments targeting predicted binding site residues

  • Molecular Dynamics Simulations:

    • Perform long-timescale molecular dynamics simulations to explore conformational dynamics

    • Study potential ligand binding and dissociation pathways

    • Investigate receptor activation mechanisms through simulation of transmembrane domain movements

  • Structure-Function Analysis Pipeline:

    • Conduct systematic mutagenesis of key residues in transmembrane domains

    • Correlate functional changes (EC50, efficacy) with structural predictions

    • Identify critical motifs that differentiate OR7C1 from related olfactory receptors

  • Integration with Multi-omics Data:

    • Correlate structural features with expression patterns across tissues

    • Link genetic variations in OR7C1 to functional outcomes and disease associations

    • Develop a unified model that connects structural features to physiological roles in both olfactory and non-olfactory tissues

What are the key knowledge gaps that need to be addressed in OR7C1 research?

Several critical knowledge gaps require focused research attention:

  • Complete Ligand Profiling:

    • Identification of physiological ligands beyond the limited set currently known

    • Determination of whether OR7C1 responds to endogenous metabolites in non-olfactory tissues

    • Characterization of the full spectrum of agonists, antagonists, and inverse agonists

  • Signaling Pathway Elucidation:

    • Comprehensive mapping of downstream signaling cascades activated by OR7C1

    • Identification of tissue-specific signaling partners and effectors

    • Determination of how OR7C1 signaling differs between olfactory neurons and cancer cells

  • Physiological Role Beyond Olfaction:

    • Investigation of the functional significance of OR7C1 expression in non-olfactory tissues

    • Determination of potential developmental roles

    • Exploration of whether OR7C1 functions as more than just a cancer biomarker

  • Evolutionary Conservation Analysis:

    • Comparative analysis of OR7C1 across species to identify conserved domains

    • Investigation of species-specific differences in ligand binding profiles

    • Understanding of selective pressures that have shaped OR7C1 evolution

What emerging technologies could revolutionize OR7C1 research?

Several cutting-edge technologies hold promise for advancing OR7C1 research:

  • Single-Cell Transcriptomics and Proteomics:

    • Analysis of OR7C1 expression at single-cell resolution in various tissues

    • Identification of co-expressed genes that may modulate OR7C1 function

    • Characterization of cell-to-cell variability in OR7C1 expression and signaling

  • Cryo-EM and Advanced Structural Biology:

    • Determination of OR7C1 structure in different conformational states

    • Visualization of ligand binding mechanisms

    • Structural comparison with other olfactory receptors

  • Organoid and Spheroid Models:

    • Development of 3D culture systems that better recapitulate the native environment

    • Study of OR7C1 function in more physiologically relevant contexts

    • Investigation of tumor-specific roles in cancer stem cell organoids

  • AI and Machine Learning Applications:

    • Prediction of novel ligands through deep learning approaches

    • Analysis of complex datasets to identify patterns in OR7C1 function

    • Integration of diverse data types for comprehensive understanding of OR7C1 biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.