Recombinant Human Olfactory receptor 7E24 (OR7E24)

Shipped with Ice Packs
In Stock

Description

Primary Features

OR7E24 belongs to the class A rhodopsin-like G protein-coupled receptors (GPCRs), the largest family of transmembrane proteins in the human genome . Key structural attributes include:

PropertyDetails
Sequence339 amino acids (1-339aa), with a conserved 7-transmembrane domain structure .
Gene LocationChromosome 19p13.2 (NC_000019.10: 920,6488–925,2625) .
TagN-terminal His-tag (10xHis) for purification and detection .
Expression SystemRecombinant production in E. coli .

Functional Role

OR7E24 is hypothesized to participate in odorant detection through G protein-mediated signaling. While its specific ligands remain uncharacterized, olfactory receptors broadly bind diverse odorants via:

  • Combinatorial coding: Single odorants activate multiple receptors, and vice versa .

  • Metalloprotein interactions: Some ORs utilize metal ions (e.g., copper) for ligand binding, though this is not confirmed for OR7E24 .

Recombinant Production Protocol

ParameterDetails
HostE. coli .
Expression RegionFull-length protein (1-339aa) .
Purity>90% (SDS-PAGE validated) .
StorageLyophilized powder stored at -20°C/-80°C .

Purification Workflow

  1. Expression: Induced in E. coli under optimized conditions .

  2. Lyophilization: Freeze-dried for stability .

  3. Reconstitution: Suggested in deionized water (0.1–1.0 mg/mL) .

Experimental Uses

ApplicationDetails
Structural StudiesUsed in circular dichroism (CD) and size-exclusion chromatography (SEC) to assess folding and oligomerization .
Ligand ScreeningPotential candidate for identifying odorant agonists/antagonists, though no direct ligands are reported .
Cancer ResearchORs (e.g., OR2B6) are biomarkers in breast carcinoma; OR7E24’s role remains unexplored .
ELISA DetectionCommercial kits (e.g., abx536576) enable quantitative detection in biological samples .

Table 2: Functional Insights from Olfactory Receptor Research

MechanismOR7E24 Relevance
G Protein ActivationShared with other ORs; cAMP signaling pathway .
Metalloprotein InteractionsUnconfirmed; some ORs use Cu²⁺ for ligand binding .
OligomerizationMonomeric/dimeric forms observed in related ORs (e.g., hOR1A1) .

Limitations and Future Directions

  • Ligand Gaps: No physiological ligands identified for OR7E24; requires deorphanization studies .

  • Structural Data: No crystallographic/NMR structures available; recombinant proteins enable future work .

  • Therapeutic Potential: ORs (e.g., OR51E2) influence cancer progression; OR7E24’s role warrants investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR7E24; OR7E24P; Olfactory receptor 7E24; Olfactory receptor OR19-14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR7E24
Target Protein Sequence
MSYFPILFFFFLKRCPSYTEPQNLTGVSEFLLLGLSEDPELQPVLAGLFLSMYLVTVLGN LLIILAVSSDSHLHTPMYFFLSNLSLADIGFTSTTVPKMIVDMQTHSRVISYEGCLTQMS FFVLFACMDDMLLSVMAYDRFVAICHPLHYRIIMNPRLCGFLILLSFFISLLDSQLHNLI MLQLTCFKDVDISNFFCDPSQLLHLRCSDTFINEMVIYFMGAIFGCLPISGILFSYYKIV SPILRVPTSDGKYKAFSTCGSHLAVVCLFYGTGLVGYLSSAVLPSPRKSMVASVMYTVVT PMLNPFIYSLRNKDIQSALCRLHGRIIKSHHLHPFCYMG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8396

KEGG: hsa:26648

STRING: 9606.ENSP00000387523

UniGene: Hs.129832

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory receptor 7E24 (OR7E24)?

Human Olfactory receptor 7E24 (OR7E24) is a member of the olfactory receptor family, which constitutes the largest subfamily of G protein-coupled receptors (GPCRs). These receptors are primarily responsible for the detection of odorants in the nose, initiating neuronal responses that trigger smell perception . OR7E24 is a 339-amino acid protein with a characteristic 7-transmembrane domain structure common to GPCRs . In the scientific literature, this receptor may also be referred to by several synonyms, including OR7E24P, OR19-14, HSHT2, and TPCR62 .

What are the optimal storage conditions for recombinant OR7E24 protein?

Recombinant OR7E24 protein requires careful handling to maintain its structural integrity and functionality. Based on established protocols, the recommended storage conditions are:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0 or Tris-based buffer with 50% glycerol
Important notesAvoid repeated freeze-thaw cycles by preparing multiple aliquots
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol

Following these storage recommendations will help preserve the protein's activity for experimental use .

How is recombinant OR7E24 typically expressed and purified?

The expression and purification of recombinant OR7E24 typically follows this methodological approach:

  • Expression system selection: E. coli is commonly used for OR7E24 expression, as it allows for high protein yields .

  • Construct design: The full-length sequence (1-339 amino acids) is fused to an N-terminal His-tag to facilitate purification .

  • Expression conditions: Optimization of temperature, induction time, and media composition is crucial for maximizing protein expression.

  • Purification process: Affinity chromatography using the His-tag is employed, followed by potential additional purification steps such as size exclusion chromatography.

  • Quality control: SDS-PAGE analysis to confirm purity (typically >90%) .

  • Final preparation: The purified protein is typically lyophilized for long-term stability .

This systematic approach ensures the production of high-quality recombinant OR7E24 protein suitable for functional studies and structural analyses.

How can researchers measure OR7E24-mediated signaling in real-time?

Real-time measurement of OR7E24-mediated signaling can be accomplished using biosensor-based approaches that detect secondary messengers. Based on established protocols for olfactory receptors, the following methodological framework is recommended:

  • Cell system preparation:

    • Express OR7E24 in a heterologous system (typically HEK293TN cells)

    • Co-express accessory proteins like RTP1s to enhance trafficking to the cell membrane

    • Incorporate appropriate biosensors for downstream signaling detection

  • Biosensor selection:

    • For calcium signaling: Use YC3.6 (Yellow Cameleon 3.6) biosensor

    • For cAMP production: Use EPAC (Exchange Protein Activated by cAMP) biosensor

  • Real-time imaging setup:

    • Configure fluorescence microscopy for time-lapse imaging

    • Establish baseline signals for 30-60 seconds before stimulus addition

    • Record for at least 120 seconds post-stimulus to capture complete response dynamics

  • Data analysis:

    • Quantify response parameters (amplitude, kinetics, duration)

    • Compare to positive controls (forskolin for cAMP, carbachol for calcium)

This approach enables the detection of signal transduction events almost instantaneously after odorant addition, with typical response times under 25 milliseconds .

What is the role of RTP1s in enhancing OR7E24 expression in heterologous systems?

RTP1s (Receptor Transporting Protein 1, short form) plays a critical role in enhancing the functional expression of olfactory receptors like OR7E24 in heterologous systems through the following mechanisms:

  • Promotion of receptor trafficking: RTP1s facilitates the transport of ORs from the endoplasmic reticulum to the plasma membrane, increasing surface expression.

  • Enhancement of functional responses: Co-expression of RTP1s has been shown to produce more robust odorant-induced responses compared to RTP1, RTP2, or REEP1 .

  • Stabilization of receptor structure: RTP1s helps maintain proper protein folding, reducing aggregation and degradation.

  • Experimental evidence: Studies have demonstrated that co-expression of just RTP1s is sufficient for robust functional expression of various ORs, particularly when using Lucy-Rho tagged constructs .

Research indicates that minimal requirements (co-expression of an OR with RTP1s) can serve as a good starting point when higher expression levels are needed for robust analysis of olfactory receptors like OR7E24 .

What are the advantages of different tagging strategies for OR7E24 expression?

Different tagging strategies significantly impact the expression and functionality of OR7E24 and other olfactory receptors in heterologous systems:

Tag TypeAdvantagesLimitationsExperimental Observations
His-tag- Simple purification via affinity chromatography
- Minimal interference with protein structure
- Well-established protocols
- Limited enhancement of membrane trafficking
- May not improve functional expression
- Commonly used for protein purification from E. coli
Rho-tag (RhoOR)- Improved trafficking to cell membrane
- Enhanced surface expression
- Less effective than Lucy-Rho in many cases
- Variable performance between receptors
- Functional in some OR-odorant pairs
- Generally lower response amplitude than Lucy-Rho
Lucy-Rho-tag (LROR)- Superior performance in most ORs tested
- More cells respond to stimuli
- Higher amplitude responses
- Faster response kinetics
- May alter protein structure
- Larger tag size
- Demonstrated better performance in almost all ORs tested
- Particularly effective with the YC3.6 biosensor
- Some ORs only showed responses with LROR variants

Research data indicates that out of 14 odorant-OR pairs tested, Lucy-Rho tagged ORs showed better performance for five pairs with both biosensors (YC3.6 and EPAC), and for additional eight pairs with at least one biosensor .

How can researchers determine the ligand specificity of OR7E24?

Determining the ligand specificity of OR7E24 requires a systematic experimental approach:

  • Screening methodology:

    • High-throughput screening: Test OR7E24 against diverse odorant libraries at different concentrations

    • Dose-response analysis: Establish EC50 values for active compounds

    • Structure-activity relationship studies: Compare responses to structurally related compounds

  • Experimental considerations:

    • Account for assay-dependent bias by using multiple experimental systems (HEK293 vs. other cell lines)

    • Consider stereochemistry of potential ligands, as ORs can show different responses to enantiomers

    • Test at various concentrations, as odorant concentration significantly affects receptor activation

  • Data analysis approach:

    • Integrate screening concentration or EC50 values for all experiments

    • Compare responses across different assay types (luciferase assays, calcium imaging, cAMP measurements)

    • Consider both agonistic and antagonistic interactions

  • Validation strategies:

    • Confirm hits with orthogonal assays

    • Evaluate specificity by testing related ORs

    • Assess potential physiological relevance of identified ligands

This comprehensive approach accounts for the complexity of OR-ligand interactions and helps establish reliable specificity profiles for OR7E24 .

What are the potential applications of OR7E24 in cancer biomarker research?

Olfactory receptors have emerging roles as potential cancer biomarkers, suggesting several research applications for OR7E24:

  • Expression profiling methodologies:

    • RNA-Seq analysis: Quantify OR7E24 expression using FPKM values across cancer types and normal tissues

    • RT-PCR validation: Confirm expression patterns with specific primers detecting 200-300 bp of the OR7E24 ORF

    • Statistical analysis: Apply appropriate tests (Student's t-test for normally distributed data, Mann-Whitney test for non-normal distributions)

  • Potential research directions:

    • Differential expression analysis: Several ORs show altered expression in various cancers, with OR2B6 highly expressed in 80% of breast carcinoma tissues while absent in normal breast tissue

    • Functional implications: Some ORs like OR2AT4 can induce proapoptotic processes upon activation, suggesting potential therapeutic applications

    • Marker development: ORs such as OR51E2, OR51E1, and OR7C1 have been identified as markers for specific cancer types

  • Technical approaches:

    • Visualization of transcript structures: Analyze read alignment using Integrated Genomics Viewer (IGV)

    • Expression threshold determination: Consider an FPKM value >0.1 as the expression threshold

    • Comparative analysis: Evaluate expression across multiple cancer cell lines and corresponding normal tissues

While OR7E24-specific cancer associations are not explicitly documented in the provided search results, these methodological approaches can be applied to investigate its potential role as a cancer biomarker.

What are the main challenges in studying OR7E24 functionality in heterologous expression systems?

Studying OR7E24 functionality in heterologous systems presents several challenges that researchers must address:

  • Limited surface expression:

    • Challenge: Olfactory receptors often show poor trafficking to the plasma membrane in heterologous cells

    • Solution: Co-express trafficking enhancers like RTP1s, which has been shown to be more effective than RTP1, RTP2, or REEP1

    • Methodology: Use Lucy-Rho tagged OR7E24 constructs for improved expression compared to standard Rho-tagged variants

  • Assay-dependent variability:

    • Challenge: Different experimental systems can produce varying results for the same OR-ligand pair

    • Solution: Test in multiple cell lines and with multiple assay types

    • Example: Some OR ligands were successfully identified in prostate carcinoma cell lines (LNCaP) but not in HEK293 cells

  • Signal detection sensitivity:

    • Challenge: Weak or transient responses may be difficult to detect

    • Solution: Use complementary biosensors like YC3.6 for calcium and EPAC for cAMP measurements

    • Consideration: Some OR variants show stronger responses with specific biosensors

  • Concentration-dependent effects:

    • Challenge: Odorant concentration significantly influences receptor activation

    • Solution: Perform dose-response experiments and determine EC50 values

    • Importance: A molecule may not induce response at low concentration but activate multiple ORs at higher concentrations

  • Protein stability issues:

    • Challenge: Recombinant ORs can be unstable during storage and handling

    • Solution: Store at -20°C/-80°C with glycerol, prepare aliquots to avoid freeze-thaw cycles

    • Protocol: For working solutions, maintain at 4°C for up to one week

Addressing these challenges through appropriate experimental design and controls is essential for reliable functional characterization of OR7E24.

How can researchers quantify OR7E24 expression in non-olfactory tissues?

Quantifying OR7E24 expression in non-olfactory tissues requires sensitive and specific methodological approaches:

  • RNA-Seq-based quantification:

    • Methodology: Generate 5-10 million reads per transcriptome with read length of 101 bp

    • Analysis pipeline: Use TopHat and Cufflinks software to map sequence reads to human reference genome (hg19)

    • Expression metrics: Calculate expression intensities using FPKM values

    • Threshold determination: Consider FPKM values >0.1 as expressed

    • Visualization: Analyze transcript structures and read distribution using Integrated Genomics Viewer (IGV)

  • RT-PCR validation:

    • RNA processing: Reverse transcribe RNA using cDNA Synthesis Kit

    • Primer design: Design primers to detect 200-300 bp of the OR7E24 ORF

    • Experimental setup: Use 50 ng RNA equivalent for each RT-PCR experiment

    • PCR conditions: 40 cycles (95°C, 59°C, 72°C, 45 seconds each)

    • Technical considerations: Conduct experiments in triplicate for statistical validation

  • Statistical analysis approach:

    • Normality testing: Apply Shapiro-Wilk test to determine distribution

    • Parametric analysis: Use two-tailed unpaired Student's t-test for normally distributed data

    • Non-parametric analysis: Apply Mann-Whitney test or Kruskal-Wallis one-way analysis for non-normal distributions

    • Significance thresholds: p < 0.05 (), p < 0.01 (), p < 0.001 ()

These complementary approaches provide a comprehensive framework for reliable quantification of OR7E24 expression in various tissue types, enabling comparative studies between normal and pathological conditions.

What experimental considerations are important when studying OR7E24 signaling mechanisms?

When investigating OR7E24 signaling mechanisms, several critical experimental considerations must be addressed:

  • G protein coupling specificity:

    • OR-mediated signaling in heterologous systems can vary from the canonical pathway

    • Traditional olfactory signaling involves Gαolf/Gs, but other G proteins may be recruited in different cellular contexts

    • Design experiments to detect multiple potential signaling pathways (cAMP, calcium, etc.)

  • Signal timing and dynamics:

    • Odorant-induced responses typically occur almost instantaneously (within 25 ms)

    • A 120-second time window is generally sufficient to capture initial responses

    • For complete responses including plateau phases, longer acquisition times may be required

    • Ensure proper controls for manual addition of stimuli, which can introduce slight timing variations

  • Biosensor selection and implementation:

    • For calcium signaling: YC3.6 (Yellow Cameleon 3.6) biosensor

    • For cAMP production: EPAC (Exchange Protein Activated by cAMP) biosensor

    • Tag selection affects signaling measurement - Lucy-Rho tagged ORs generally show superior performance

    • Include appropriate positive controls (forskolin for cAMP, carbachol for calcium)

  • Signaling cascade components:

    • Upon odorant binding, the OR undergoes structural changes

    • G protein (Gαolf and/or Gαs) activation leads to adenylate cyclase stimulation

    • ATP is converted to cAMP, which opens cyclic nucleotide-gated ion channels

    • Calcium and sodium influx causes depolarization and action potential generation

    • Design experiments to monitor each step of this cascade

  • Data analysis considerations:

    • Normalize responses to baseline and/or maximum stimulation

    • Account for cell-to-cell variability

    • Analyze both the percentage of responding cells and the response amplitude

    • Consider kinetic parameters (response onset, duration, decay)

These considerations provide a methodological framework for comprehensive investigation of OR7E24 signaling mechanisms, ensuring reliable and reproducible results.

How does the choice of experimental system affect OR7E24 functional studies?

The choice of experimental system significantly impacts OR7E24 functional studies in several key ways:

  • Cell line considerations:

    • HEK293/HEK293TN: Most commonly used for OR functional studies

    • Hana3A cells: Engineered to express chaperon proteins (RTP1, RTP2), olfactory G-protein, and rho tag; represent 41% of bioassay results in OR databases

    • LNCaP cells: Prostate carcinoma cells where some ORs show responses not detected in HEK293

    • Experimental impact: Different cell backgrounds can reveal distinct ligand specificities

  • Assay format selection:

    • Luciferase assays: High-throughput, good for screening but less dynamic information

    • Calcium imaging: Real-time measurement with good spatial resolution

    • cAMP measurements: Direct assessment of canonical OR signaling

    • Considerations: Different assays may yield varying results for the same OR-ligand pair

  • Tag and construct design impacts:

    • Tag comparison: Lucy-Rho tagged OR7E24 likely provides better results than Rho-tagged versions

    • Evidence: In studies of multiple ORs, Lucy-Rho tagged variants showed superior performance

      • More cells responded to stimuli

      • Responses had higher amplitude

      • Responses occurred faster

    • Receptor specificity: Some ORs (e.g., OR8K3) only showed responses with Lucy-Rho tagged variants

  • Accessory protein requirements:

    • Minimal system: Co-expression of OR7E24 with just RTP1s can be sufficient

    • Enhanced system: Addition of Gαolf, and Ric8b may further improve performance

    • Optimization: Different ORs may require different combinations of accessory proteins

  • Data correlation across platforms:

    • System-specific thresholds: Define appropriate response thresholds for each experimental system

    • Comparative analysis: When possible, test key findings in multiple systems

    • Validation approaches: Confirm heterologous system findings in more native contexts when available

This systematic consideration of experimental variables enables researchers to design optimal studies for OR7E24 characterization and to appropriately interpret results across different experimental platforms.

What are emerging approaches for studying OR7E24 structure-function relationships?

Emerging approaches for investigating OR7E24 structure-function relationships include:

  • Computational modeling and simulation:

    • Homology modeling based on other GPCR crystal structures

    • Molecular dynamics simulations to predict ligand binding sites

    • Binding energy calculations for potential ligands

    • In silico mutagenesis to identify key functional residues

  • High-resolution structural studies:

    • Cryo-electron microscopy (cryo-EM) for structure determination

    • X-ray crystallography of stabilized receptor constructs

    • NMR studies of specific domains or peptide fragments

    • Structural comparison with other olfactory receptors with known ligands

  • Advanced mutagenesis approaches:

    • Systematic alanine scanning mutagenesis of transmembrane domains

    • Creation of chimeric receptors with other ORs to identify functional domains

    • Site-directed mutagenesis guided by computational predictions

    • Analysis of naturally occurring variants and polymorphisms

  • Novel functional readouts:

    • BRET/FRET-based conformational sensors

    • Label-free technologies for receptor activation detection

    • Single-molecule imaging of receptor dynamics

    • Multiparametric analysis of signaling pathways

  • Integration with emerging databases:

    • Utilization of databases like M2OR that include concentration data and stereochemistry information

    • Comparative analysis across multiple ORs to identify common structural features

    • Machine learning approaches to predict structure-function relationships

These emerging approaches will provide deeper insights into OR7E24 structure-function relationships, potentially enabling rational design of modulators and better understanding of its physiological roles.

How might OR7E24 research contribute to understanding sensory perception mechanisms?

OR7E24 research has significant potential to advance our understanding of sensory perception mechanisms through several research pathways:

  • Receptor coding principles:

    • Investigation of how OR7E24 contributes to the combinatorial code of odor perception

    • Analysis of its ligand specificity profile compared to other ORs

    • Determination of its activation threshold and dynamic range

    • Integration of these findings into broader models of olfactory coding

  • Signal transduction mechanisms:

    • Elucidation of the G protein coupling specificity of OR7E24

    • Characterization of the temporal dynamics of OR7E24-mediated signaling

    • Investigation of potential non-canonical signaling pathways

    • Comparison with signaling mechanisms of other olfactory receptors

  • Neuronal circuit integration:

    • Mapping of neurons expressing OR7E24 in the olfactory epithelium

    • Tracing of their projections to the olfactory bulb

    • Analysis of their synaptic connectivity patterns

    • Correlation with perceptual outcomes in behavioral studies

  • Concentration-dependent perception:

    • Analysis of how OR7E24 activation changes with ligand concentration

    • Investigation of potential differences in perception at varying concentrations

    • Comparison with other ORs to understand concentration-dependent coding

    • Integration into models of odor intensity perception

  • Comparative evolutionary analysis:

    • Examination of OR7E24 orthologs across species (human, canine, macaque)

    • Analysis of sequence conservation and functional divergence

    • Investigation of species-specific differences in ligand recognition

    • Insights into evolutionary adaptation of olfactory systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.