Recombinant Human Olfactory receptor 8B12 (OR8B12)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Olfactory receptor 8B12 (OR8B12) is a protein-coding gene product that belongs to the olfactory receptor family, specifically family 8, subfamily B, member 12. It is also known by the alternative name OR11-317 . As a member of the G-protein-coupled receptor 1 family, OR8B12 is a 310 amino acid multi-pass membrane protein that functions primarily in the detection of odor molecules in the nasal cavity . The recombinant form of this protein is produced through biotechnological methods, typically using bacterial expression systems such as E. coli, to enable various research applications . The protein shares the characteristic seven-transmembrane domain structure common to many neurotransmitter and hormone receptors, which facilitates its role in signal transduction across cell membranes .

Genomic Location and Structure

The gene encoding OR8B12 is located on human chromosome 11q24.2, a region that houses numerous genes implicated in various physiological functions and pathological conditions . Chromosome 11 comprises nearly 4% of the human genome and contains over 1,400 genes, including those associated with several genetic disorders such as Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome . The OR8B12 gene consists of more than 900 bases and, like other olfactory receptor genes, arises from a single coding-exon gene . The olfactory receptor gene family represents the largest gene family in the human genome, with its nomenclature assigned independently of other organisms .

Protein Structure and Domains

OR8B12 exhibits the canonical structure of G-protein-coupled receptors, featuring seven hydrophobic transmembrane domains that span the cell membrane . This structural arrangement is optimized for the protein's function in detecting odorant molecules and transducing signals across the plasma membrane. The receptor is classified under the G protein-coupled receptor 1 family according to its structural and functional characteristics . This seven-transmembrane domain structure is conserved among olfactory receptors and is crucial for their ability to bind odorant molecules and activate downstream signaling pathways that ultimately lead to odor perception .

Physical and Chemical Properties

As a transmembrane protein, OR8B12 exhibits hydrophobic properties consistent with its membrane-spanning domains. The protein's stability is temperature-dependent, with recommended storage conditions at -20°C for short-term storage and -20°C to -80°C for extended storage . The shelf life of the liquid form is generally 6 months when stored at -20°C or -80°C, while the lyophilized form can remain stable for up to 12 months under similar storage conditions . Repeated freezing and thawing are not recommended as they may compromise the protein's structural integrity and functional activity . For working applications, aliquots can be stored at 4°C for up to one week to minimize degradation from repeated temperature changes .

Role in Olfactory System

OR8B12 plays a critical role in the olfactory system by functioning as an odorant receptor . Its primary function is to interact with specific odorant molecules in the nasal cavity, initiating a cascade of neuronal responses that ultimately lead to the perception of smell . This process begins when volatile odorant molecules bind to the receptor's binding pocket, causing conformational changes in the protein structure that activate associated G proteins . The Gene Ontology annotations for OR8B12 confirm its involvement in the sensory perception of smell (GO_0007608) and the detection of chemical stimuli involved in this sensory process (GO_0050911) .

G Protein-Coupled Receptor Signaling

As a G protein-coupled receptor, OR8B12 mediates signal transduction through interaction with G proteins . The receptor's Gene Ontology annotations include G protein-coupled receptor activity (GO_0004930) and G protein-coupled receptor signaling pathway (GO_0007186), confirming its role in this signaling mechanism . Upon binding of an odorant molecule, the receptor undergoes conformational changes that enable it to activate G proteins, initiating a signaling cascade that ultimately results in the generation of action potentials in olfactory sensory neurons . This signaling pathway is essential for translating chemical stimuli into electrical signals that can be processed by the brain to perceive specific odors .

Molecular Interactions

The specificity of OR8B12 for particular odorant molecules is determined by the structural features of its binding pocket, which is formed by the arrangement of its transmembrane domains . The receptor exhibits odorant binding activity, as indicated by its Gene Ontology annotation (GO_0005549) . While the exact range of odorant molecules that activate OR8B12 has not been fully characterized in the provided search results, olfactory receptors generally respond to a specific subset of volatile compounds . This specificity contributes to the discriminatory power of the human olfactory system, which can distinguish thousands of different odors through the combined activation patterns of multiple olfactory receptors .

Tissue Distribution

While olfactory receptors are primarily expected to be expressed in olfactory epithelium consistent with their role in olfaction, analysis of OR8B12 expression reveals a more complex pattern . According to the OmnibusX gene expression database, OR8B12 shows minimal expression across multiple tissues examined, with no substantial scRNA-seq data available for its expression at the single-cell or tissue level . This limited expression pattern aligns with the specialized function of olfactory receptors in sensory perception rather than general cellular processes .

Expression Levels

Bulk RNA sequencing data provides insights into the expression levels of OR8B12 across various tissues. The highest expression, though still very low, is observed in the esophagus with 0.01 average TPM (Transcripts Per Million) in GTEx (Genotype-Tissue Expression) data and 0.02 average TPM in TCGA (The Cancer Genome Atlas) data . Other tissues such as breast, intestine, adipose, and skin show minimal expression (0.01 TPM), while most tissues show no detectable expression at all . The tissue coverage percentages are consistently low, with esophagus showing the highest coverage at 2% in TCGA data . This restricted expression pattern underscores the specialized nature of olfactory receptors and their primary localization in specific sensory neurons.

Table 1: Expression of OR8B12 across different tissues based on RNA-seq data

TissueGTEx CoverageGTEx Average TPMTCGA CoverageTCGA Average TPM
Esophagus0%0.012%0.02
Pancreas0%01%0.01
Breast0%0.010%0.00
Stomach0%00%0.01
Intestine0%0.010%0.01
Lung0%00%0.00
Adipose0%0.010%0
Kidney0%00%0.00
Skin0%0.010%0
Brain0%0.000%0

Expression Systems

Recombinant Human Olfactory receptor 8B12 is produced using in vitro expression systems, with E. coli being a common platform for bacterial expression . According to the Cusabio datasheet, the recombinant protein is generated in an in vitro E. coli expression system to ensure proper folding and functionality . The production process typically involves the insertion of the OR8B12 gene into an expression vector, transformation of the vector into bacterial cells, induction of protein expression, and subsequent purification . The recombinant protein is often produced with an N-terminal 10xHis-tag to facilitate purification using metal affinity chromatography and to enhance detection in experimental settings .

Research Applications

Recombinant OR8B12 serves as a valuable tool in various research contexts, particularly in studies focused on olfactory signal transduction, structure-function relationships of G protein-coupled receptors, and the molecular basis of olfaction . It can be used in binding assays to identify and characterize odorant molecules that activate the receptor, in structural studies to elucidate the three-dimensional architecture of olfactory receptors, and in cell-based assays to investigate downstream signaling pathways . Additionally, the availability of siRNA for OR8B12 (such as the Santa Cruz Biotechnology product sc-96660) enables knockdown experiments to study the receptor's function through loss-of-function approaches .

Associated Disorders

While OR8B12 itself has not been directly implicated in specific clinical disorders based on the provided search results, it is located on chromosome 11q24.2, a region that contains genes associated with various pathological conditions . These include Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome . Alterations in olfactory receptor genes, including potentially OR8B12, may contribute to variations in olfactory perception among individuals and potentially to disorders of smell, although specific evidence for OR8B12's involvement is not provided in the search results .

Potential Therapeutic Applications

The understanding of olfactory receptors at the molecular level, including OR8B12, has potential implications for the development of therapeutic approaches for olfactory disorders . As G protein-coupled receptors represent one of the most important classes of drug targets in pharmaceutical research, insights gained from the study of OR8B12 may contribute to the broader field of GPCR-targeted drug discovery . The availability of recombinant OR8B12 and related research tools such as siRNA enables investigations that could potentially lead to novel therapeutic strategies for conditions characterized by altered olfactory function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare accordingly to meet your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8B12; Olfactory receptor 8B12; Olfactory receptor OR11-317
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8B12
Target Protein Sequence
MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL RRTLGRKIFS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15307

KEGG: hsa:219858

STRING: 9606.ENSP00000307159

UniGene: Hs.553634

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 8B12 and what family does it belong to?

Olfactory Receptor 8B12 (OR8B12) belongs to the G-protein coupled receptor 1 family. Like other olfactory receptors, it interacts with odorant molecules in the nasal cavity to initiate neuronal responses that ultimately trigger smell perception. Olfactory receptors are members of a large family of G-protein-coupled receptors (GPCRs) that arise from single coding-exon genes . These receptors share a characteristic 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals . Notably, the olfactory receptor gene family represents the largest gene family in the genome, highlighting its biological significance in sensory perception.

What is the fundamental structure of OR8B12?

OR8B12, like other olfactory receptors, exhibits the canonical structure of G protein-coupled receptors (GPCRs), featuring seven transmembrane domains (7TM) . The protein structure also encompasses three intracellular loops (ICLs) and three extracellular loops (ECLs) . The transmembrane regions form the core structure of the receptor, while the loops play crucial roles in signal transduction and ligand binding. The extracellular loops, particularly ECL2 and ECL3, have been identified as important elements in shaping the odorant-binding pocket and regulating receptor activation . This structural arrangement creates a specialized binding pocket that determines the receptor's selectivity for specific odorant molecules.

How does OR8B12 function in olfactory sensation?

OR8B12 functions by binding to specific odorant molecules, which triggers a conformational change in the receptor. This structural alteration activates associated G proteins, initiating an intracellular signaling cascade that ultimately results in action potentials being sent to the brain for odor perception. Research on olfactory receptors has revealed that structural changes, particularly in the Extracellular Loop 3 (ECL3), can trigger receptor activation . When an odorant molecule binds to the receptor's binding pocket, it forms both polar interactions (hydrogen and ionic bonds) and non-specific hydrophobic interactions with the receptor protein . This binding mechanism is highly selective, with the volume and shape of the binding pocket determining which odorant molecules can effectively bind and activate the receptor.

What are the most effective methods for expressing recombinant OR8B12 in laboratory settings?

Expressing functional recombinant olfactory receptors like OR8B12 in laboratory settings presents several challenges due to their hydrophobic nature and tendency to misfold when overexpressed. An effective approach involves using specialized expression systems such as HEK293 cells with specific chaperone proteins to facilitate proper folding. The methodology should include:

  • Codon optimization of the OR8B12 sequence for the expression system

  • Incorporation of N-terminal tags (such as Rho or Lucy tags) to facilitate trafficking to the cell membrane

  • Co-expression with accessory proteins like Receptor Transporting Protein 1 (RTP1) and Receptor Expression Enhancing Protein 1 (REEP1)

  • Use of inducible expression systems to control expression levels

  • Expression at lower temperatures (30°C instead of 37°C) to reduce protein aggregation

The expression construct should be designed to include appropriate purification tags (such as His-tag or FLAG-tag) for subsequent isolation of the recombinant protein. For functional studies, co-expression with appropriate G proteins is essential to reconstitute the signaling pathway necessary for receptor activation assessment.

How can researchers design experimental protocols to study OR8B12 ligand binding properties?

To effectively study OR8B12 ligand binding properties, researchers should employ a systematic experimental design approach that incorporates multiple complementary techniques:

  • Computational prediction and screening:

    • Utilize molecular dynamics simulations to predict potential ligands based on binding pocket characteristics

    • Employ virtual screening approaches to identify candidate odorant molecules

    • Generate a diverse library of odorant candidates for experimental validation

  • Functional assays for ligand identification:

    • Calcium imaging assays using OR8B12-expressing cells loaded with calcium-sensitive dyes

    • BRET/FRET-based assays to measure receptor conformational changes upon ligand binding

    • cAMP accumulation assays to measure G protein-mediated signaling

  • Direct binding studies:

    • Competitive binding assays using radiolabeled or fluorescently labeled reference ligands

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

  • Structural validation:

    • Site-directed mutagenesis of predicted binding pocket residues to confirm their role in ligand binding

    • Crosslinking studies to identify points of contact between receptor and ligand

Each experimental approach should include appropriate positive and negative controls, dose-response measurements, and technical replicates to ensure data reliability and reproducibility .

What quality control measures should be implemented when working with recombinant OR8B12?

When working with recombinant OR8B12, implementing rigorous quality control measures is essential to ensure experimental validity and reproducibility. Key quality control procedures should include:

  • Expression verification:

    • Western blot analysis using specific antibodies to confirm protein expression at the expected molecular weight

    • Immunofluorescence microscopy to verify proper membrane localization

    • Flow cytometry to quantify surface expression levels

  • Functional validation:

    • Ligand-induced calcium mobilization assays to confirm receptor functionality

    • GTPγS binding assays to verify G protein coupling capability

    • Dose-response curves with known odorants to establish baseline sensitivity

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal stability assays to evaluate protein folding

    • Limited proteolysis to confirm proper folding of transmembrane domains

  • Purity analysis:

    • SDS-PAGE with Coomassie or silver staining to assess homogeneity

    • Size exclusion chromatography to detect aggregation

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Batch-to-batch consistency checks:

    • Standardized functional assays with reference compounds

    • Comparative analysis of key parameters across production batches

    • Implementation of internal standards for quantitative comparisons

Researchers should maintain detailed records of all quality control data and establish acceptance criteria for each parameter to ensure consistent experimental outcomes .

How can molecular dynamics simulations enhance our understanding of OR8B12 odorant binding mechanisms?

Molecular dynamics (MD) simulations provide powerful insights into the dynamic interactions between OR8B12 and potential odorant molecules at an atomic level. To effectively apply MD simulations to OR8B12 research:

  • Model preparation and validation:

    • Generate a high-quality structural model of OR8B12 using homology modeling based on available GPCR structures or AlphaFold2 predictions

    • Validate the model through energy minimization and assessment of stereochemical parameters

    • Embed the receptor model in a lipid bilayer that mimics the natural membrane environment

  • Simulation protocols:

    • Perform all-atom simulations in explicit solvent with physiological ion concentrations

    • Run multiple independent simulations (5-10) of sufficient length (100-500 ns each) to capture relevant conformational dynamics

    • Implement enhanced sampling techniques such as metadynamics or umbrella sampling to explore binding/unbinding events

  • Analysis of binding pocket dynamics:

    • Identify key residues involved in ligand recognition by analyzing contact frequencies

    • Characterize the volume and shape fluctuations of the binding pocket

    • Evaluate the contributions of specific interactions (hydrogen bonds, π-π stacking, hydrophobic contacts) to binding stability

  • Integration with experimental data:

    • Use simulation results to guide site-directed mutagenesis experiments

    • Validate computational predictions through functional assays

    • Iteratively refine the model based on experimental feedback

MD simulations have revealed that olfactory receptors tend to establish bonds with the transmembrane regions TM-3, TM-5, and TM-6, and that hydrogen bonding and π-π stacking play pivotal roles in stabilizing aromatic odorant compounds . For OR8B12 specifically, simulations can help elucidate the mechanisms of selectivity for its cognate ligands and provide structural insights that are challenging to obtain experimentally.

What are the challenges and solutions in developing high-throughput screening assays for OR8B12 ligand discovery?

Developing high-throughput screening (HTS) assays for OR8B12 ligand discovery presents several significant challenges along with potential solutions:

Challenges:

  • Poor membrane expression - Olfactory receptors often express poorly in heterologous systems

  • Signal-to-noise limitations - Low expression levels lead to weak signaling responses

  • Promiscuous binding - Some olfactory receptors respond to multiple structurally diverse odorants

  • Assay miniaturization - Adapting functional assays to 384 or 1536-well formats while maintaining sensitivity

  • Compound volatility - Odorant molecules are often volatile, creating challenges for consistent compound delivery

Solutions:

  • Expression optimization:

    • Use specialized cell lines with enhanced GPCR expression capabilities

    • Incorporate N-terminal fusion tags proven to enhance OR trafficking

    • Co-express with receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs)

  • Signal amplification strategies:

    • Implement chimeric G proteins (e.g., Gα15/16) to channel signaling to calcium mobilization

    • Use engineered cell lines with amplified reporter systems (e.g., luciferase, BRET)

    • Employ signal optimization through kinetics-based measurements

  • Assay design considerations:

    • Develop cell-based assays that maintain viability in miniaturized formats

    • Implement real-time monitoring to capture transient responses

    • Use sealed plates and controlled environmental conditions to minimize odorant volatilization

  • Screening library design:

    • Create focused libraries based on computational predictions

    • Include structurally diverse compounds to probe binding pocket versatility

    • Incorporate known ligands of related ORs as positive controls

  • Data analysis approaches:

    • Implement robust statistical methods to distinguish true hits from false positives

    • Use machine learning algorithms to identify structure-activity relationships

    • Develop models that account for the unique pharmacology of olfactory receptors

Recent advances in high-throughput screening have enabled the identification of agonists for multiple orphan olfactory receptors, demonstrating the feasibility of this approach when properly optimized .

How can structural biology approaches be applied to elucidate the binding mechanisms of OR8B12?

Structural biology approaches provide crucial insights into the binding mechanisms of olfactory receptors like OR8B12. While historically challenging due to the difficulty in crystallizing membrane proteins, recent technological advances have enabled significant progress:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle cryo-EM has revolutionized GPCR structural biology, allowing visualization without crystallization

    • For OR8B12, stabilization strategies may include:
      a) Use of conformational antibodies or nanobodies as stabilizing partners
      b) Introduction of thermostabilizing mutations
      c) Incorporation into nanodiscs or amphipols to maintain native-like membrane environment

    • Recent cryo-EM studies of related olfactory receptors have revealed that propionic acid, a short-chain fatty acid, can be entrapped in a compact binding pocket, forming both polar interactions and hydrophobic interactions

  • X-ray crystallography:

    • While challenging, crystallography may be attempted with:
      a) Fusion protein strategies (e.g., T4 lysozyme fusion) to enhance crystallization
      b) Lipidic cubic phase crystallization methods
      c) Heavy-atom derivative preparation for phase determination

  • NMR spectroscopy:

    • Solution NMR of the full receptor is challenging, but fragment-based approaches can provide valuable information:
      a) Study isolated ECL or TM domain fragments in membrane-mimetic environments
      b) Use selective isotopic labeling to focus on binding site residues
      c) Employ paramagnetic relaxation enhancement to map ligand binding sites

  • Computational integration:

    • Homology modeling based on related GPCR structures

    • Refinement using experimental constraints from mutagenesis and binding studies

    • Molecular dynamics simulations to explore conformational dynamics

  • Complementary biochemical approaches:

    • Hydrogen-deuterium exchange mass spectrometry to identify regions protected upon ligand binding

    • Disulfide cross-linking to map receptor conformational changes

    • Site-directed mutagenesis to validate key binding residues

The recent structure determination of OR51E2, a human olfactory receptor, has revealed that the receptor entraps odorant molecules in a compact binding pocket, with the volume of this pocket (31 ų) playing a crucial role in determining ligand selectivity . Similar approaches could be applied to OR8B12 to elucidate its specific binding mechanisms.

How should researchers design experiments to investigate OR8B12 signaling pathways?

Designing robust experiments to investigate OR8B12 signaling pathways requires careful consideration of multiple factors:

  • Experimental system selection:

    • Heterologous expression systems:

      • HEK293 cells: Widely used, easily transfectable, but may lack some components of olfactory signaling

      • Hana3A cells: Modified HEK293 cells optimized for olfactory receptor expression

      • Sf9 insect cells: Useful for higher protein expression yields

    • Primary cells or tissues:

      • Isolated olfactory sensory neurons: Physiologically relevant but technically challenging

      • Olfactory epithelium explants: Maintain tissue architecture and native signaling components

  • Pathway component identification:

    • Determine G protein coupling preferences (Gαolf, Gαs, or others)

    • Evaluate adenylyl cyclase activation and cAMP production

    • Assess calcium mobilization pathways

    • Investigate potential β-arrestin recruitment and receptor internalization

  • Experimental design framework:

    • Independent variables:

      • Ligand concentration (dose-response relationships)

      • Ligand structural variations

      • Expression levels of signaling components

    • Dependent variables:

      • cAMP production

      • Calcium flux

      • ERK phosphorylation

      • Receptor internalization rates

    • Control variables:

      • Temperature and pH

      • Cell density and passage number

      • Transfection efficiency

  • Methodological approaches:

    • Real-time signaling measurements:

      • BRET/FRET-based sensors for cAMP, calcium, or conformational changes

      • Impedance-based cellular assays for integrated responses

    • Endpoint measurements:

      • cAMP ELISA or radioimmunoassay

      • Western blotting for phosphorylated signaling proteins

    • Pathway inhibition/modulation:

      • Pharmacological inhibitors at different pathway levels

      • siRNA knockdown of specific signaling components

      • CRISPR/Cas9 genome editing to create signaling component knockouts

  • Validation strategies:

    • Positive controls using receptors with well-characterized signaling properties

    • Comparison of multiple readouts to confirm pathway engagement

    • Systematic testing of potential off-target effects

Each experiment should include appropriate statistical design, with power analysis to determine sample sizes, randomization methods, and blinding procedures where applicable .

What are the optimal conditions for functional characterization of recombinant OR8B12?

The functional characterization of recombinant OR8B12 requires carefully optimized conditions to ensure reliable and reproducible results. Key parameters include:

  • Expression system optimization:

    • Cell type selection:

      • Hana3A cells (modified HEK293T cells) expressing RTP1S, RTP2, REEP1, and Gαolf provide enhanced receptor trafficking

      • Inducible expression systems to control expression levels and timing

    • Expression construct design:

      • Inclusion of N-terminal rhodopsin or Lucy tag to enhance membrane expression

      • Codon optimization for the expression system

      • Incorporation of cleavable purification tags if protein isolation is required

  • Assay buffer composition:

    • pH: Typically 7.2-7.4 to mimic physiological conditions

    • Calcium concentration: 1-2 mM extracellular Ca²⁺

    • Buffer type: HBSS or Ringer's solution supplemented with glucose

    • Additives: 0.1% BSA to reduce non-specific binding of hydrophobic odorants

    • Osmolarity: 290-310 mOsm/kg to maintain cell health

  • Assay protocol parameters:

    • Calcium imaging:

      • Dye loading: Optimized duration (30-60 minutes) and concentration

      • Cell density: 20,000-40,000 cells per well in 96-well format

      • Reading parameters: Excitation/emission wavelengths, frequency, and duration

    • cAMP measurements:

      • Timing: Pre-incubation with phosphodiesterase inhibitors (15-30 minutes)

      • Stimulation time: Optimized for peak response (typically 5-15 minutes)

      • Odorant delivery: Methods to minimize volatilization and ensure consistent exposure

  • Compound handling:

    • Fresh preparation of odorant dilutions to minimize degradation

    • Use of sealed plates to prevent cross-contamination between wells

    • Controlled temperature (typically room temperature, 22-25°C)

    • Consideration of solvent effects (DMSO concentration <0.1%)

    • Sequential dilution protocols to ensure accuracy at low concentrations

  • Quality control metrics:

    • Positive controls: Known olfactory receptor ligands to validate assay function

    • Negative controls: Buffer-only and non-transfected cell responses

    • Reference compounds: Dose-response curves for standardization

    • Acceptance criteria: Signal-to-background ratio >3, Z' factor >0.5 for HTS assays

Optimization should be conducted systematically, varying one parameter at a time and assessing the impact on signal amplitude, signal-to-noise ratio, and response kinetics. Documentation of optimal conditions is essential for ensuring reproducibility across experiments and between laboratories.

How can researchers address discrepancies in OR8B12 ligand binding data between different experimental approaches?

Addressing discrepancies in OR8B12 ligand binding data across different experimental approaches requires a systematic troubleshooting and validation strategy:

  • Methodological comparison and standardization:

    • Create a detailed comparison table of experimental conditions across methods

    • Standardize key parameters where possible (cell type, expression construct, buffer composition)

    • Implement a common set of reference compounds across all assay platforms

    • Calibrate concentration-response relationships using standard curves

  • Assay-specific considerations:

    Assay TypePotential IssuesValidation Approaches
    Calcium imagingInterference from endogenous receptors, indirect measurement of receptor activationPerform in receptor-null cells, use Gα16 coupling to bypass specificity
    cAMP assaysTemporal differences in signal, phosphodiesterase activityTime-course experiments, consistent use of inhibitors
    Direct binding assaysNon-specific binding, altered receptor conformationCareful background subtraction, native membrane preparation
    Reporter gene assaysSignal amplification differences, transcriptional effectsNormalize to receptor expression, use short response elements
    ElectrophysiologySingle-cell variability, access resistance changesIncrease biological replicates, monitor series resistance
  • Systematic analysis of discrepancies:

    • Potency differences:

      • Generate parallel concentration-response curves across platforms

      • Calculate EC50/IC50 values with confidence intervals to assess statistical significance of differences

      • Consider the influence of receptor reserve on apparent potency in different systems

    • Efficacy differences:

      • Normalize responses to a common reference compound

      • Consider pathway-specific amplification factors

      • Evaluate receptor expression levels across systems

    • Selectivity profile inconsistencies:

      • Test a panel of structurally related compounds across all platforms

      • Generate selectivity fingerprints to identify platform-specific biases

      • Consider the influence of off-target binding in complex systems

  • Orthogonal validation approaches:

    • Perform site-directed mutagenesis of predicted binding site residues to confirm mechanism

    • Use competitive binding studies to verify direct interactions

    • Apply biophysical methods (SPR, ITC) to confirm binding independently of signaling

    • Employ computational modeling to rationalize discrepancies based on structural insights

  • Integrated data analysis framework:

    • Weight evidence based on assay directness (direct binding > proximal signaling > distal effects)

    • Apply Bayesian statistical approaches to integrate data across platforms

    • Consider developing a composite score that accounts for results across methodologies

    • Document all discrepancies transparently in publications to advance field understanding

By systematically addressing discrepancies between experimental approaches, researchers can develop a more comprehensive and accurate understanding of OR8B12 ligand interactions, leading to more reliable structure-activity relationships and physiological insights.

How does OR8B12 compare structurally and functionally to other human olfactory receptors?

A comprehensive comparison of OR8B12 with other human olfactory receptors reveals important structural and functional relationships:

  • Phylogenetic positioning:

    • OR8B12 belongs to the OR8 family, which is part of the Class II (phylogenetic group) olfactory receptors found only in tetrapods

    • The receptor shows closest sequence homology to other members of the OR8B subfamily, particularly OR8B3 and OR8B8

    • Sequence conservation is highest in the transmembrane domains, particularly in regions associated with G protein coupling

  • Structural comparison:

    FeatureOR8B12OR51E2 (Structurally characterized OR)Other ORs (General)
    Binding pocket sizePredicted medium-sizedSmall (31 ų) Variable (30-400 ų)
    Key binding residuesTM3, TM5, TM6 predictedTM3, TM5, TM6, TM7 confirmed Primarily TM3, TM5, TM6
    ECL configurationStandard GPCR loopsECL3 important for activation Variable importance of ECL2 and ECL3
    Conserved motifsMAYDRYVAIC in TM3MAYDRYVAIC in TM3MAYDRYVAIC in TM3 (class-specific)
  • Functional characteristics:

    • Like other olfactory receptors, OR8B12 couples primarily to Gαolf, leading to adenylyl cyclase activation

    • The binding specificity of OR8B12 is determined by the unique architecture of its binding pocket

    • Compared to structurally characterized ORs like OR51E2, which specifically binds short-chain fatty acids due to its small binding pocket , OR8B12's ligand preferences would be dictated by its own unique binding pocket configuration

    • The receptor likely exhibits the common feature of olfactory receptors in recognizing multiple structurally related odorants with varying affinities

  • Comparative expression patterns:

    • Like most olfactory receptors, OR8B12 is primarily expressed in olfactory sensory neurons

    • Each olfactory sensory neuron typically expresses only one type of olfactory receptor

    • The expression pattern of OR8B12 in the olfactory epithelium follows the zonal organization characteristic of olfactory receptors

    • Unlike some olfactory receptors that show ectopic expression in non-olfactory tissues, current evidence suggests OR8B12 expression is predominantly restricted to olfactory tissues

Understanding these comparative aspects provides valuable context for OR8B12 research and can guide experimental approaches based on knowledge gained from better-characterized olfactory receptors.

What evolutionary insights can be gained from studying OR8B12 across species?

Studying OR8B12 across species provides valuable evolutionary insights into olfactory system development and adaptation:

  • Phylogenetic distribution and conservation:

    • OR8B12 orthologs can be identified in various mammalian species, including primates, rodents, and other mammals

    • Sequence conservation analysis reveals:

      • Highest conservation in transmembrane domains, particularly those involved in structural integrity

      • Variable conservation in the binding pocket, reflecting species-specific adaptations

      • Consistent conservation of G protein coupling interfaces across species

  • Adaptive evolution signatures:

    • Calculated dN/dS ratios (non-synonymous to synonymous substitution rates) across species can identify:

      • Regions under purifying selection (conserved functional domains)

      • Sites under positive selection (potentially involved in species-specific odor detection)

    • Binding pocket residues often show signatures of positive selection, reflecting adaptation to ecological niches

    • Extracellular loops typically display greater variability than transmembrane regions

  • Functional divergence analysis:

    • Comparative ligand screening across species can reveal:

      • Conservation of core recognition profiles for essential odorants

      • Species-specific sensitivity to ecologically relevant compounds

      • Shifts in agonist efficacy or potency reflecting ecological adaptations

    • Experimental validation using species-specific OR8B12 variants can confirm functional predictions from sequence analysis

  • Genomic context and regulation:

    • Analysis of promoter regions across species reveals conservation of regulatory elements

    • OR8B12's chromosomal location within OR gene clusters provides insights into evolutionary expansion through gene duplication

    • Copy number variations across species may reflect ecological importance of specific odor detection capabilities

  • Comparative case studies with ecological context:

    • Comparison between human OR8B12 and rat OR8B12 may reveal adaptations related to:

      • Dietary differences and food detection capabilities

      • Predator avoidance mechanisms

      • Social communication adaptations

    • Correlation of receptor properties with environmental niches can establish structure-function relationships

The evolutionary study of OR8B12 contributes to our broader understanding of how sensory systems adapt to environmental challenges and how genetic variation translates to functional diversity in chemosensory perception across species.

How can CRISPR/Cas9 gene editing be utilized to study OR8B12 function in olfactory sensory neurons?

CRISPR/Cas9 gene editing offers powerful approaches for investigating OR8B12 function in its native context:

  • Knockout strategies for loss-of-function studies:

    • Complete gene deletion:

      • Design sgRNAs targeting 5' and 3' ends of the OR8B12 gene

      • Generate knockout models in relevant systems (mouse models or olfactory neuron cultures)

      • Analyze phenotypic consequences on odor detection and discrimination

    • Functional domain disruption:

      • Target critical domains (binding pocket, G protein coupling interface)

      • Create specific mutations that maintain protein expression but eliminate function

      • Assess changes in odorant responsiveness using electrophysiology or calcium imaging

  • Knock-in approaches for mechanistic studies:

    • Reporter gene insertion:

      • Replace or tag OR8B12 with fluorescent proteins to track expression patterns

      • Incorporate activity-dependent reporters to visualize activation in real-time

      • Create bicistronic constructs to maintain OR8B12 function while enabling cell identification

    • Site-specific mutations:

      • Introduce point mutations in predicted binding pocket residues

      • Create chimeric receptors with domains from other ORs to assess domain functions

      • Generate humanized versions in model organisms to study human-specific functions

  • Base editing and prime editing applications:

    • Use base editors for precise nucleotide changes without double-strand breaks

    • Employ prime editing to introduce specific mutations with minimal off-target effects

    • Create allelic series with graduated functional changes to assess structure-function relationships

  • Single-cell and spatial applications:

    • Lineage tracing:

      • Combine CRISPR editing with barcode systems to track developmental fate of OR8B12-expressing neurons

      • Analyze circuit formation and axonal targeting of OR8B12 neurons

    • Spatial transcriptomics integration:

      • Combine CRISPR perturbations with spatial transcriptomics to assess zone-specific effects

      • Map consequences of OR8B12 manipulation on the olfactory bulb projection patterns

  • Technical considerations for olfactory system applications:

    • Delivery methods for olfactory epithelium (adenoviral vectors, electroporation)

    • Timing considerations for developmental studies

    • Validation strategies using antibody staining or RNA in situ hybridization

    • Functional validation using odor-guided behavioral assays

CRISPR/Cas9 approaches provide unprecedented specificity for dissecting OR8B12 function in its native context, enabling connections between molecular mechanisms and sensory perception at the organismal level.

What are the latest advancements in protein engineering techniques applicable to OR8B12 research?

Recent advancements in protein engineering offer innovative approaches for enhancing OR8B12 research:

  • Stabilized receptor design:

    • Computational stability prediction:

      • Use algorithms like Rosetta to identify destabilizing residues in OR8B12

      • Design mutations that enhance thermostability while maintaining function

      • Implement directed evolution approaches coupled with stability screening

    • Fusion protein strategies:

      • Incorporate T4 lysozyme or BRIL (thermostabilized apocytochrome b562) into ICL3

      • Apply minimal G protein mimetics (nanobodies or mini G proteins) to stabilize active states

      • Develop conformationally selective antibodies or DARPins as crystallization chaperones

  • Designer olfactory receptors:

    • Chimeric receptor engineering:

      • Create chimeras between OR8B12 and well-expressed GPCRs to improve expression

      • Swap binding pocket residues with related ORs to alter ligand specificity

      • Develop OR8B12 variants with modified G protein coupling preferences

    • Synthetic biology approaches:

      • Design orthogonal olfactory receptor-ligand pairs for selective activation

      • Incorporate unnatural amino acids at key positions to probe binding mechanisms

      • Create split receptors for protein complementation assays

  • Advanced expression and purification technologies:

    • Insect cell expression optimization:

      • Apply multi-baculovirus expression systems for co-expression with accessory proteins

      • Implement inducible promoters for temporal control of expression

      • Develop specialized cell lines with enhanced membrane protein processing

    • Detergent-free systems:

      • Nanodiscs with optimized lipid compositions for OR8B12 stabilization

      • Polymer-based systems (SMALPs, amphipols) for native-like membrane environments

      • Cell-free expression directly into artificial membranes

  • Biosensor development:

    • FRET/BRET-based sensors:

      • Design OR8B12-based FRET sensors with conformation-sensitive fluorophore placement

      • Develop BRET pairs for monitoring ligand binding and G protein recruitment

      • Create multiplexed sensors for simultaneous monitoring of multiple signaling pathways

    • Synthetic cellular systems:

      • Engineer yeast or bacterial systems expressing OR8B12 with synthetic signaling pathways

      • Develop scalable reporter systems for high-throughput screening

      • Create organoid systems with OR8B12-expressing cells for tissue-level studies

  • Computational protein design applications:

    • Apply AlphaFold2 and RoseTTAFold for improved structural predictions of OR8B12

    • Utilize molecular dynamics simulations to optimize engineered variants

    • Implement machine learning approaches to predict binding properties of modified receptors

These protein engineering advances provide researchers with powerful tools to overcome traditional challenges in olfactory receptor research, enabling deeper insights into OR8B12 structure, function, and pharmacology.

How might single-cell transcriptomics and spatial omics approaches advance our understanding of OR8B12 in the olfactory system?

Single-cell transcriptomics and spatial omics approaches offer unprecedented insights into OR8B12 biology within the complex architecture of the olfactory system:

  • Single-cell transcriptomic applications:

    • Cell type identification and characterization:

      • Profile the transcriptional signature of OR8B12-expressing olfactory sensory neurons

      • Identify co-expressed genes that may regulate OR8B12 function or signaling

      • Discover potential supporting cell interactions specific to OR8B12 neurons

    • Developmental trajectory analysis:

      • Map OR8B12 neuron differentiation from progenitor cells

      • Identify transcription factors regulating OR8B12 expression

      • Characterize temporal dynamics of receptor expression during development and regeneration

    • Comparative analysis across conditions:

      • Evaluate changes in OR8B12 neurons following odor exposure or learning

      • Assess aging-related changes in receptor expression and cellular function

      • Compare healthy tissue to pathological states (inflammation, injury)

  • Spatial transcriptomics approaches:

    • Zonal distribution mapping:

      • Characterize the spatial distribution of OR8B12-expressing neurons within the olfactory epithelium

      • Correlate OR8B12 expression with topographical organization of the epithelium

      • Identify spatial relationships with supporting cells and other neuronal subtypes

    • Circuit mapping applications:

      • Trace projections from OR8B12 neurons to specific glomeruli in the olfactory bulb

      • Map the complete circuit from sensory neuron to cortical processing

      • Identify potential convergence or divergence in projection patterns

  • Multi-omic integration:

    • Single-cell multi-omics:

      • Combine transcriptomics with epigenetic profiling to understand OR8B12 regulation

      • Correlate protein expression (proteomics) with transcriptional activity

      • Link metabolomic profiles to functional states of OR8B12 neurons

    • Spatial multi-omics:

      • Integrate spatial transcriptomics with protein localization data

      • Correlate receptor expression with local signaling molecule gradients

      • Map receptor-ligand interactions across the tissue microenvironment

  • Technological considerations for olfactory applications:

    TechnologyApplication to OR8B12 ResearchAdvantagesChallenges
    Single-cell RNA-seqProfiling OR8B12+ neuronsComprehensive transcriptomePotential mRNA degradation during dissociation
    MERFISHSpatial mapping of OR8B12 expressionHigh multiplexing capacityComplex tissue preparation
    Slide-seqSpatial profiling with histological contextMaintains tissue architectureLimited gene detection
    Patch-seqLinking electrophysiology to transcriptomeDirect function-gene correlationTechnical difficulty
    Spatial ATAC-seqChromatin accessibility mappingRegulatory landscape insightsComplex data interpretation
  • Analytical frameworks:

    • Pseudotime analysis to reconstruct developmental trajectories

    • RNA velocity to predict future transcriptional states

    • Gene regulatory network inference to identify OR8B12 regulators

    • Spatial statistics to quantify distribution patterns and clustering

These approaches collectively enable unprecedented insights into how OR8B12 neurons develop, function, and connect within the olfactory system, bridging molecular mechanisms to sensory function at the systems level.

What is the potential significance of OR8B12 research for understanding olfactory disorders?

OR8B12 research contributes significantly to our understanding of olfactory disorders through several key mechanisms:

  • Genetic variation and specific anosmias:

    • Polymorphisms in OR8B12 may contribute to specific anosmias (inability to detect particular odors)

    • Genome-wide association studies can link OR8B12 variants to phenotypic variations in odor perception

    • Understanding the molecular basis of OR8B12 function helps explain individual differences in odor sensitivity and perception

    • Genotype-phenotype correlations may reveal how receptor variants influence odor detection thresholds

  • Mechanisms of olfactory dysfunction:

    • OR8B12 research provides insights into general mechanisms of olfactory receptor function that apply broadly to olfactory disorders

    • Studies of OR8B12 trafficking and membrane expression inform our understanding of congenital anosmias

    • Investigation of signaling pathways downstream of OR8B12 helps elucidate potential points of disruption in acquired olfactory dysfunction

    • Research on receptor desensitization and adaptation contributes to understanding temporary olfactory fatigue

  • Aging and neurodegenerative connections:

    • Age-related changes in OR8B12 expression may contribute to the decline in olfactory function observed in elderly populations

    • Olfactory dysfunction is an early symptom in neurodegenerative diseases like Parkinson's and Alzheimer's

    • OR8B12 research contributes to the broader understanding of how olfactory sensory neurons maintain function throughout the lifespan

    • Molecular mechanisms of receptor maintenance and turnover provide insights into neuroprotective strategies

  • Post-viral olfactory dysfunction:

    • Research on OR8B12 expression and function following viral infection (particularly relevant in post-COVID-19 anosmia)

    • Understanding mechanisms of olfactory epithelium regeneration and receptor re-expression after injury

    • Investigation of inflammatory effects on receptor signaling efficacy

    • Development of models to test interventions for accelerating recovery of olfactory function

  • Diagnostic and therapeutic implications:

    • Development of molecular diagnostic tools based on OR8B12 and related receptor genetics

    • Design of targeted therapies to enhance receptor expression or function in specific disorders

    • Creation of personalized olfactory testing batteries based on receptor genotypes

    • Potential for gene therapy approaches targeting olfactory receptor expression

The translational potential of OR8B12 research extends beyond rare specific anosmias to inform our broader understanding of normal olfactory function and pathological states, potentially leading to novel diagnostic and therapeutic approaches for olfactory disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.