Recombinant Human Olfactory receptor 8B4 (OR8B4)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Protein Classification

The human OR8B4 gene is located on chromosome 11 and encodes the Olfactory receptor 8B4 protein . Like other olfactory receptors, OR8B4 belongs to the superfamily of G-protein-coupled receptors (GPCRs), specifically within the class A rhodopsin-like family . The gene is also known by alternative names including OR8B4P and OR11-315, and is formally designated as "olfactory receptor family 8 subfamily B member 4 (gene/pseudogene)" .

The olfactory receptor gene family is notably the largest in the human genome, consisting of approximately 400 genes, compared to around 1400 genes in mice . This extensive genetic diversity underlies the remarkable ability of mammals to detect and discriminate between thousands of different odorous compounds. Olfactory receptors interact with odorant molecules in the nose to initiate a neuronal response that triggers the perception of smell .

Table 1: Identification Nomenclature for Human OR8B4

Identifier TypeDesignation
Gene NamesOR8B4, OR8B4P, OR11-315
Alternative NamesOlfactory receptor 8B4, olfactory receptor family 8 subfamily B member 4 (gene/pseudogene)
Chromosome LocationChromosome 11
UniProt AccessionQ96RC9
Gene ID283162

Protein Structure and Domains

OR8B4, like other olfactory receptors, exhibits the canonical structure of G-protein-coupled receptors (GPCRs), featuring seven transmembrane domains (7TM) that span the cell membrane . These transmembrane regions are connected by three extracellular loops (ECL) and three intracellular loops (ICL) . This structural arrangement creates a complex three-dimensional configuration that enables the receptor to interact with specific odorant molecules and transduce signals across the cell membrane.

The protein consists of 309 amino acids with a molecular weight of approximately 34.4 kDa. The transmembrane domains form a barrel-like structure that creates a binding pocket for odorant molecules. This binding pocket is critical for the receptor's function in detecting specific odorants and initiating signal transduction. The specific structural features of the binding pocket determine which odorant molecules can effectively interact with the receptor.

Recent advances in structural biology, particularly cryo-electron microscopy, have begun to elucidate the detailed structures of human olfactory receptors . Research has revealed that structural alterations induced in Extracellular Loop 3 (ECL3) by odorant molecules can trigger the activation of human olfactory receptors, as demonstrated in the case of OR51E2 . While specific structural details for OR8B4 remain limited, computational approaches, including molecular dynamics simulations and AI-powered structure prediction tools like AlphaFold2, have contributed significantly to understanding the structural features of olfactory receptors in general .

Expression Systems

Recombinant Human Olfactory receptor 8B4 can be produced using various expression systems, each with distinct advantages and limitations. Commercial sources offer recombinant OR8B4 produced in different host systems, including cell-free expression, E. coli, yeast, baculovirus, and mammalian cell systems . The choice of expression system significantly impacts the quality, yield, and functional characteristics of the recombinant protein.

Table 2: Comparison of Expression Systems for Recombinant OR8B4 Production

Expression SystemAdvantagesLimitationsTypical Purity
Cell-Free Expression Rapid production, avoids cell toxicity issuesLimited post-translational modifications≥85% by SDS-PAGE
E. coli High yield, cost-effectiveLimited post-translational modifications, potential inclusion bodies≥85% by SDS-PAGE
Yeast Eukaryotic post-translational modificationsLower yield than bacterial systems≥85% by SDS-PAGE
Baculovirus Complex eukaryotic post-translational modificationsHigher cost, longer production time≥85% by SDS-PAGE
Mammalian Cell Native-like post-translational modificationsHighest cost, complex culture conditions≥85% by SDS-PAGE

The selection of an appropriate expression system depends on the specific research requirements, including the need for post-translational modifications, protein folding considerations, and cost constraints. For applications requiring high functional fidelity, mammalian or insect cell systems may be preferred despite their higher cost and complexity. For structural studies or applications where post-translational modifications are less critical, bacterial or cell-free systems may offer advantages in terms of yield and cost-effectiveness.

Purification and Quality Control

Following expression, recombinant OR8B4 requires purification to remove host cell proteins and other contaminants. Standard purification protocols typically involve affinity chromatography, size exclusion chromatography, and other techniques appropriate for membrane proteins. The purification of membrane proteins like OR8B4 presents unique challenges due to their hydrophobic nature and requirement for detergents or lipid environments to maintain structural integrity.

Quality control of commercially available recombinant OR8B4 typically involves SDS-PAGE analysis to confirm protein purity, with standards typically requiring ≥85% purity . Additional quality control measures may include Western blotting, mass spectrometry, and functional assays to confirm protein identity and activity. These quality control measures are essential to ensure the reliability and reproducibility of research results obtained using the recombinant protein.

The purified recombinant protein is typically provided in a lyophilized format, which requires reconstitution in an appropriate buffer before use . Proper storage is essential, with recommendations including refrigeration at 2-8°C for short-term storage (up to 6 months) and -20°C for long-term storage . These storage conditions help preserve the structural integrity and functional activity of the recombinant protein over time.

Tissue Distribution

Understanding the natural expression patterns of OR8B4 provides important context for its functional significance. According to data from the Human Protein Atlas and GTEx, OR8B4 shows a relatively limited expression pattern across human tissues . This restricted expression profile is consistent with the specialized functions of olfactory receptors in sensory perception.

The highest expression levels are observed in specific brain regions, particularly the piriform cortex and hypothalamus. This brain-specific expression pattern aligns with the role of olfactory receptors in odor perception, as the piriform cortex is a primary region for processing olfactory information. The expression in the hypothalamus suggests potential involvement in neuroendocrine functions beyond pure olfactory sensation.

Outside the central nervous system, olfactory receptors, including OR8B4, have been detected in various tissues, though at generally low levels. Interestingly, research has identified olfactory receptors in unexpected locations, including sperm cells, where they are thought to play a role in chemotaxis to locate the egg cell . This extra-nasal expression suggests broader physiological roles for olfactory receptors beyond their canonical function in smell perception.

The relatively low expression levels of OR8B4 across most tissues (generally 0-0.4 TPM in GTEx data) are typical for olfactory receptor genes, which often show highly specialized expression patterns. This specialized expression likely reflects the evolutionary adaptation of these receptors for specific sensory functions.

Subcellular Localization

At the subcellular level, OR8B4, like other olfactory receptors, is primarily localized to the cell membrane, consistent with its function as a transmembrane receptor . In olfactory sensory neurons, these receptors are specifically expressed in both the cilia and synapses . This localization is critical for their function in detecting odorant molecules in the nasal mucosa and transmitting signals to the brain.

The trafficking of olfactory receptors to the cell surface is a complex process that involves various chaperone proteins and quality control mechanisms. Efficient expression of functional recombinant OR8B4 at the cell surface often represents a technical challenge, which has implications for functional studies and therapeutic applications. Optimizing the cell surface expression of recombinant OR8B4 remains an important consideration for in vitro studies of receptor function.

Ligand Binding and Activation

Olfactory receptors, including OR8B4, interact with odorant molecules through their binding pocket, which is formed by the arrangement of the seven transmembrane domains . Rather than binding to specific ligands with high selectivity, olfactory receptors typically display affinity for a range of odor molecules with similar chemical properties . This pattern of broad selectivity enables the olfactory system to detect and discriminate thousands of different odors with a limited number of receptor types.

For OR8B4 specifically, research has identified potential ligands including Muguet alcohol, with alcohol C6 also suggested as a possible activator. The binding pocket characteristics, including its volume and amino acid composition, determine the specificity of these interactions. The interaction between odorant molecules and the receptor involves various types of non-covalent interactions, including hydrophobic interactions, hydrogen bonds, and ionic bonds.

Recent research on the human olfactory receptor OR51E2 provides insights into how binding pocket volume plays a crucial role in determining receptor selectivity for odorant molecules . The limited volume of the OR51E2 binding pocket (31 ų) accommodates short-chain fatty acids while preventing the binding of longer chains . Similar structural constraints likely influence OR8B4's ligand specificity. Mutation studies have shown that altering key residues in the binding pocket can significantly change the ligand selectivity of olfactory receptors .

Signaling Pathways

Once an odorant molecule binds to OR8B4, the receptor undergoes a conformational change that triggers the activation of associated G proteins . As with other olfactory receptors, OR8B4 likely couples primarily with the olfactory-specific G protein (Golf) and/or Gs . This G protein coupling initiates the intracellular signaling cascade that ultimately leads to neuronal activation.

The specific signaling pathway, as documented for olfactory receptors, involves the following steps :

  1. Odorant binding causes the receptor to undergo structural changes

  2. The activated receptor binds and activates the olfactory-type G protein (Golf and/or Gs)

  3. The G protein activates adenylate cyclase, which converts ATP to cyclic AMP (cAMP)

  4. Increased cAMP opens cyclic nucleotide-gated ion channels

  5. Calcium and sodium ions enter the cell, depolarizing the olfactory receptor neuron

  6. An action potential is generated, carrying the olfactory information to the brain

This signaling cascade represents the fundamental mechanism by which odorant detection is converted into neuronal activity, ultimately leading to the perception of smell. The specificity and sensitivity of this process determine our ability to detect and discriminate different odors in our environment.

Current Research Trends

Research on olfactory receptors, including OR8B4, has seen significant advances in recent years, particularly in the areas of structural biology and molecular mechanisms. The development of cryo-electron microscopy techniques has made it possible to decipher the specific structures of olfactory receptors in insects and humans, representing a major breakthrough in the field . These structural insights are essential for understanding the molecular basis of odorant recognition and receptor activation.

Molecular dynamics simulations have emerged as a powerful tool for understanding the binding mechanisms between odorant molecules and receptors . These simulations allow researchers to explore the three-dimensional motions of biomolecules and dissect the fundamental mechanisms governing their physiological functions and interactions with potential ligands . This computational approach complements experimental methods and provides insights that may be difficult to obtain through structural studies alone.

The integration of AlphaFold2's protein structure prediction capabilities with these simulations has further expanded their applications in deciphering molecular mechanisms, protein design, and drug development . This integration has propelled progress in understanding olfactory receptors, including potentially OR8B4. The combination of advanced computational methods with experimental approaches represents a promising direction for future research in this field.

AI-powered approaches for receptor deorphanization—the process of identifying ligands for orphan receptors—have shown promising results, with models achieving significant hit rates in identifying novel odorant-receptor pairs. These advances are likely to accelerate research on previously understudied olfactory receptors like OR8B4, potentially leading to a more comprehensive understanding of their functions and interactions.

Potential Clinical Relevance

Beyond its role in olfaction, OR8B4 has been implicated in other physiological processes. Notably, gene-based burden tests have identified OR8B4 in relation to major depressive disorder, suggesting potential involvement in psychiatric conditions. This finding aligns with emerging evidence suggesting broader roles for olfactory receptors beyond sensory perception.

Research on rat orthologs has shown that various chemicals can affect OR8B4 gene methylation and expression, indicating potential environmental influences on its function . Compounds such as benzo[a]pyrene and bisphenol A have been documented to decrease methylation of the OR8B4 gene, while bisphenol A has also been shown to increase methylation in different experimental contexts . Other compounds, including cadmium dichloride, CGP 52608, fulvestrant, and valproic acid, have also been reported to alter the methylation status of the OR8B4 gene . These epigenetic modifications could have significant implications for gene expression and function, potentially influencing various physiological processes.

The availability of research reagents like OR8B4 antibodies suggests ongoing laboratory investigation into its potential roles beyond olfaction . As research progresses, our understanding of OR8B4's broader physiological significance is likely to expand, potentially revealing new therapeutic targets or biomarkers for various conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
OR8B4; OR8B4P; Olfactory receptor 8B4; Olfactory receptor OR11-315
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8B4
Target Protein Sequence
MTLRNSSSVTEFILVGLSEQPELQLPLFLLFLGIYVFTVVGNLGLITLIGINPSLHTPMY FFLFNLSFIDLCYSCVFTPKMLNDFVSESIISYVGCMTQLFFFCFFVNSECYVLVSMAYD RYVAICNPLLYMVTMSPRVCFLLMFGSYVVGFAGAMAHTGSMLRLTFCDSNVIDHYLCDV LPLLQLSCTSTHVSELVFFIVVGVITMLSSISIVISYALILSNILCIPSAEGRSKAFSTW GSHIIAVALFFGSGTFTYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLAL GKTLKRVLF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8473

KEGG: hsa:283162

STRING: 9606.ENSP00000348449

UniGene: Hs.553671

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR8B4 and what is its genomic context?

Olfactory receptor family 8 subfamily B member 4 (OR8B4) is a protein-coding gene belonging to the large family of G-protein-coupled receptors (GPCRs). It is classified within the olfactory receptor family, which represents the largest gene family in the human genome. OR8B4 contains a single coding exon and encodes a receptor with a characteristic 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors. The gene is involved in the recognition and G protein-mediated transduction of odorant signals, initiating the neuronal response that triggers smell perception .

What is the current classification status of OR8B4?

OR8B4 is classified as a segregating pseudogene in humans. This means that within the human population, some individuals carry an allele that encodes a functional olfactory receptor, while others possess an allele encoding a protein predicted to be non-functional. This polymorphic pseudogene status creates interesting research opportunities for studying genetic variation in olfactory perception among different populations .

What are the known synonyms and identifiers for OR8B4?

The gene has several recognized identifiers that researchers should be aware of when conducting literature searches or database queries:

Identifier TypeValue
Gene SymbolOR8B4
Entrez Gene ID283162
SynonymsOR11-315, OR8B4P
Gene TypeProtein-coding
OrganismHomo sapiens (human)

This information is crucial for ensuring comprehensive literature searches and avoiding confusion with similarly named genes .

What are the recommended experimental designs for studying OR8B4 expression patterns?

When studying OR8B4 expression patterns, researchers should implement a quantitative experimental research design with clearly defined variables. Given the gene's status as a segregating pseudogene, a comparative design is particularly valuable. The experimental approach should include:

  • A clear control group (individuals with non-functional alleles) and experimental group (individuals with functional alleles)

  • Quantitative PCR (qPCR) to measure expression levels across different tissues

  • Time-series analysis to assess potential temporal variations in expression

  • Statistical analysis frameworks that account for individual variation

This approach allows researchers to establish the relationship between genotype and expression patterns while controlling for confounding variables. The experimental design should be structured to address the causal relationship between genetic variants and functional outcomes .

How should researchers approach the production of recombinant OR8B4 protein?

Production of recombinant OR8B4 presents specific challenges due to its membrane-bound nature as a GPCR. A methodological approach should include:

  • Selection of an appropriate expression system (typically mammalian cells like HEK293 or insect cells)

  • Optimization of codon usage for the selected expression system

  • Incorporation of affinity tags that minimally interfere with protein folding

  • Implementation of solubilization and purification protocols specific to membrane proteins

  • Validation of protein functionality through ligand binding assays

Researchers should be particularly attentive to protein folding and post-translational modifications, as these are critical for GPCR functionality. The experimental design should include multiple validation steps to confirm that the recombinant protein maintains native-like properties .

How do I design experiments to investigate the functional consequences of OR8B4 polymorphisms?

When investigating OR8B4 polymorphisms, researchers should implement a comprehensive experimental design that addresses both genetic variation and functional outcomes. A methodological approach includes:

  • Genotyping participants to identify functional and non-functional allele carriers

  • Implementing odorant response assays using a calcium mobilization or cAMP accumulation readout

  • Developing structure-function relationship studies through site-directed mutagenesis

  • Correlating genotypes with phenotypic data through statistical modeling

This approach requires careful control of experimental variables and consideration of potential confounding factors. The experimental design should incorporate both in vitro functional studies and, where possible, in vivo olfactory perception tests to establish correlations between genotype and phenotype .

What methods are most effective for analyzing OR8B4 ligand interactions?

OR8B4 ligand interaction studies require specialized approaches due to the challenges associated with olfactory receptor research. Recommended methodological procedures include:

  • High-throughput screening using calcium imaging or BRET/FRET-based assays

  • Computational modeling of the binding pocket based on homology models

  • Structure-activity relationship studies with panels of structurally related odorants

  • Validation of hits through dose-response curves and competition assays

  • Molecular dynamics simulations to understand binding kinetics

These methods should be implemented with appropriate controls, including known ligands for related olfactory receptors and negative controls (non-odorant molecules). The experimental design should address the specificity of interactions and potential cross-reactivity with other olfactory receptors .

How should researchers approach the integration of OR8B4 expression data with functional studies?

Integration of expression and functional data requires sophisticated analytical approaches. Researchers should:

  • Implement correlation analyses between expression levels and functional readouts

  • Develop multivariate models that account for genetic background and environmental factors

  • Apply dimensionality reduction techniques to identify patterns in complex datasets

  • Consider temporal dynamics of both expression and functional responses

This integration allows researchers to connect molecular mechanisms with functional outcomes. The analytical framework should be designed to test specific hypotheses while remaining open to unexpected patterns in the data .

What statistical approaches are most appropriate for analyzing polymorphic variation in OR8B4?

Given OR8B4's status as a segregating pseudogene, statistical analysis of polymorphic variation requires specialized approaches:

  • Implementation of multilevel modeling to account for individual and population-level variation

  • Application of genotype-phenotype association tests with appropriate corrections for multiple testing

  • Development of logistic regression models to predict functional status based on sequence variants

  • Incorporation of evolutionary analyses to understand selective pressures

The table below outlines key statistical considerations for different types of OR8B4 analyses:

Analysis TypeRecommended Statistical ApproachKey Considerations
Expression AnalysisMultilevel regression modelsAccount for between- and within-subject effects
Functional VariationLogistic regressionControl for population stratification
Evolutionary AnalysisSelection tests (dN/dS)Consider lineage-specific patterns
Phenotype AssociationMixed-effects modelsInclude relevant covariates

These statistical approaches should be selected based on the specific research question and data structure, with careful attention to assumptions and potential biases .

How can single-cell sequencing technologies be applied to OR8B4 research?

Single-cell sequencing offers unprecedented opportunities for understanding OR8B4 expression at the cellular level. A methodological framework includes:

  • Selection of appropriate single-cell isolation techniques for olfactory tissues

  • Implementation of protocols optimized for low-abundance transcripts

  • Development of computational pipelines for analyzing heterogeneous cell populations

  • Integration of spatial information to map expression patterns

This approach allows researchers to characterize cell-specific expression patterns and identify potential regulatory mechanisms. The experimental design should include appropriate quality control measures and validation of findings through orthogonal methods .

What are the cutting-edge approaches for studying OR8B4 in complex cellular environments?

To study OR8B4 in complex cellular environments that better approximate physiological conditions, researchers should consider:

  • Development of organoid models representing olfactory epithelium

  • Implementation of microfluidic systems for controlled stimulus delivery

  • Application of advanced imaging techniques for real-time monitoring of receptor activation

  • Integration of multi-omics data to understand system-level responses

These approaches move beyond reductionist models to capture the complexity of olfactory signaling in more physiologically relevant contexts. The experimental design should include appropriate controls and validation steps to ensure that the model systems accurately represent in vivo processes .

How can researchers address the challenges of reproducibility in OR8B4 functional studies?

Reproducibility challenges in OR8B4 research require systematic methodological approaches:

  • Implementation of standardized protocols for protein expression and functional assays

  • Development of reference materials and positive controls

  • Detailed reporting of experimental conditions, including cell passage number and reagent sources

  • Preregistration of study designs and analysis plans

These practices enhance reproducibility by reducing variability and increasing transparency. The experimental approach should include validation across different laboratories and experimental platforms when possible .

What strategies can address the limitations of current OR8B4 structural models?

Current structural understanding of OR8B4 is limited by the challenges of membrane protein crystallography. To address these limitations, researchers should:

  • Implement integrative modeling approaches combining computational predictions with experimental constraints

  • Develop cryo-EM protocols optimized for GPCRs

  • Apply molecular dynamics simulations to refine structural models

  • Validate structural predictions through mutagenesis and functional assays

This multifaceted approach leverages complementary methods to overcome the limitations of any single technique. The experimental design should include critical assessment of model quality and explicit acknowledgment of uncertainty .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.