Recombinant Human Olfactory receptor 8B8 (OR8B8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Olfactory Receptor 8B8 (OR8B8)

Recombinant Human Olfactory Receptor 8B8 (OR8B8) is a synthetic variant of the human olfactory receptor protein produced through genetic engineering. It belongs to the family 8, subfamily B of olfactory receptors, a subset of G-protein-coupled receptors (GPCRs) responsible for detecting odorant molecules . OR8B8 is encoded by the gene OR8B8 (synonyms: TPCR85, JCG8) and shares structural homology with other olfactory receptors, including a 7-transmembrane domain architecture . Its recombinant forms are widely used in research to study olfactory signaling mechanisms, ligand binding, and receptor engineering.

Production and Expression Systems

OR8B8 is produced via recombinant expression in diverse systems, each with distinct advantages:

Expression SystemSourceTagPurityApplications
Baculovirus (Insect Cells)CSB-BP620887HU1Undisclosed>85% (SDS-PAGE)Native folding, structural studies
E. coliCSB-EP620887HU1, CSB-CF620887HUN-terminal 10xHis-tag>85%High-throughput screening, biochemical assays
HEK293 CellsNot explicitly reportedFLAG/rho1D4 tagsNot specifiedFunctional assays (e.g., cAMP/luciferase)
  • Key considerations:

    • E. coli systems yield cost-effective partial proteins but may lack post-translational modifications .

    • Baculovirus systems produce full-length receptors closer to native conformations .

Functional Studies and Research Applications

OR8B8 is employed in diverse experimental workflows:

Bioassay Methods

AssayPurposeReagents/ToolsReferences
cAMP/LuciferaseMeasure G-protein signalingGloSensor™, HEK293 cells
Calcium ImagingDetect odorant-induced Ca²⁺ fluxHana3A cells, RTP/Ric-8B chaperones
ELISA/Western BlotValidate protein expressionRabbit anti-OR8B8 polyclonal antibody (Boster A15378)

Challenges

  • Deorphanization: OR8B8’s ligands remain unknown due to limitations in heterologous expression systems .

  • Assay Bias: Responses may vary between cell lines (e.g., HEK293 vs. LNCaP) .

Research Challenges and Future Directions

  • Structural Elucidation: No crystallographic/NMR data exists for OR8B8, limiting mechanistic insights .

  • Ligand Discovery: High-throughput screening using platforms like M2OR (a database of OR-odorant pairs) may accelerate deorphanization .

  • Therapeutic Potential: OR8B8’s role in non-olfactory tissues (e.g., sperm, prostate) hints at broader physiological functions warranting investigation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8B8; Olfactory receptor 8B8; Olfactory receptor TPCR85; Olfactory-like receptor JCG8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8B8
Target Protein Sequence
MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMY FFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAY DRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCD ILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFST CSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVA LKKILNKNAFS
Uniprot No.

Target Background

Function
Odorant receptor (Potential). May be involved in taste perception.
Database Links

HGNC: 8477

KEGG: hsa:26493

STRING: 9606.ENSP00000330280

UniGene: Hs.351822

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the tongue and testis.

Q&A

What expression systems are most effective for producing Recombinant OR8B8?

Multiple expression systems have been validated for OR8B8 production, each with distinct advantages for different research applications:

Host SystemAdvantagesLimitationsRecommended Applications
Escherichia coliHighest yield, cost-effective, rapid productionMay lack post-translational modifications, potential inclusion body formationStructural studies, antibody production
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher solubilityLower yields than bacterial systemsFunctional studies requiring glycosylation
Baculovirus/insect cellsNear-native folding, suitable for membrane proteinsMore complex methodology, higher costLigand binding assays, structural studies
Mammalian cells (HEK293, Hana3A)Most physiologically relevant expressionLowest yields, highest costFunctional assays, deorphanization studies

For functional studies, the Hana3A cell line is particularly valuable as it expresses chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, which facilitate proper OR folding and trafficking to the cell membrane . When designing expression vectors, pET-based systems are commonly employed for bacterial expression.

Methodologically, researchers should carefully select the expression system based on their specific experimental requirements rather than defaulting to the highest-yielding system.

What storage and handling protocols maximize OR8B8 stability?

Optimal storage conditions for maintaining OR8B8 stability and activity:

FormStorage TemperatureShelf LifeHandling Recommendations
Lyophilized-20°C to -80°C12 monthsMinimize humidity exposure during handling
Liquid (reconstituted)-20°C to -80°C6 monthsAliquot to avoid freeze-thaw cycles
Working stock4°CUp to 1 weekPrepare fresh from frozen stocks for critical experiments

Buffer composition significantly impacts stability. For pre-lyophilization preparation, Tris/PBS with 6% trehalose is recommended as a cryoprotectant. When reconstituting, use 0.1–1.0 mg/mL in sterile water supplemented with 5–50% glycerol to prevent protein aggregation.

Methodologically important: Repeated freeze-thaw cycles should be strictly avoided as they dramatically reduce protein activity. For experimental work, prepare small working aliquots and store at 4°C for up to one week rather than repeatedly freezing and thawing stocks .

What are the putative functions and ligand interactions of OR8B8?

OR8B8 functions within the combinatorial coding system of olfaction:

Function TypeDetailsExperimental Evidence
Putative ligandsAldehydes or ketones based on structural homologyPredicted from OR subfamily comparisons
Signaling mechanismLigand-induced Ca²⁺ flux (GPCR hallmark)Validated in HEK293 cells and Xenopus oocytes
Expression patternPrimary: olfactory epithelium; Secondary: testesSuggests potential pleiotropic functions
Combinatorial codingEach OR recognizes multiple odorants; each odorant activates multiple ORsFundamental principle of olfactory perception

OR8B8 belongs to a subfamily whose members typically respond to structurally similar odorants, though direct ligand validation remains limited . The receptor's genomic organization suggests it evolved through local gene duplication events, potentially specializing in the detection of specific chemical structures .

For methodological rigor, researchers should note that OR responsiveness is highly concentration-dependent. A molecule may show no activity at low concentrations but become an agonist when concentration increases .

How do genetic variations impact OR8B8 expression and function across populations?

OR8B8 sits in a genomic region (11p15.4) known to be prone to copy number variations (CNVs), which creates a complex landscape of individual variation:

Variation TypePrevalenceFunctional ImpactResearch Implications
CNV deletionsMore common than gains in human OR genesPotential loss of function, reduced receptor diversityMay relate to human-specific diminution of OR repertoire
Multi-locus CNVs~50% of OR CNVs involve multiple genesCoordinated loss/gain of functionally related ORsCreates "mosaics" of OR dosages across individuals
Human-specific deletionsAll common OR deletion alleles are human-derivedContributes to reduced human olfactory repertoire compared to other primatesPotential evolutionary signature of reduced olfactory reliance

Methodological approach: To study OR8B8 variation, high-resolution oligonucleotide tiling microarrays specifically designed for OR genomic loci provide superior detection compared to standard CNV arrays. This methodology identified 93 OR gene loci and 151 pseudogene loci affected by CNVs across individuals with ancestry from three populations .

For validation, quantitative PCR targeting OR8B8 should be performed, as some CNVs may be missed by array-based methods. Comparison to non-human primate reference genomes can determine whether variants are ancestral or derived in humans .

What methodological considerations are crucial for OR8B8 deorphanization studies?

Deorphanization (identifying ligands) for OR8B8 requires careful consideration of experimental variables:

Methodological FactorCritical ConsiderationsBest Practices
Cell line selectionDifferent cell backgrounds can yield contradictory resultsTest multiple cell lines (e.g., HEK293, Hana3A, LNCaP) for each potential ligand
Assay systemLuciferase, calcium imaging, and electrophysiology have different sensitivitiesValidate positive hits using orthogonal assay methods
Ligand concentrationOR activation is highly concentration-dependentTest wide concentration ranges (nM to μM) and report EC₅₀ values
StereochemistryORs can distinguish between enantiomersFully characterize stereochemistry of test compounds
Control receptorsBackground response validationInclude both positive control ORs and mock-transfected controls

Research has demonstrated clear assay-dependent bias in OR deorphanization. For example, novel ligands for certain ORs were successfully identified in human prostate carcinoma cell lines (LNCaP) but showed no activity when the same ORs were expressed in HEK293 cells .

Methodologically, researchers should implement a tiered approach: initial screening with a sensitive reporter system (e.g., luciferase assay using Hana3A cells), followed by validation using calcium imaging and dose-response characterization, with final confirmation via electrophysiological recordings or in vivo validation where possible.

How does OR8B8 contribute to the broader olfactory coding system?

OR8B8 operates within the complex combinatorial coding system of olfaction:

Understanding OR8B8's role requires considering that even minor alterations in the functionality of a single receptor can lead to notable perceptual consequences . The receptor's contribution must be viewed within the broader context of how a relatively small number of receptors (a few hundred) enable discrimination of tens of thousands of odors .

Methodologically, researchers can use the M2OR database—the largest collection of OR-molecule interactions—to compare OR8B8 response patterns with those of related receptors. This database uniquely includes information on stereochemistry, concentration, and non-responsive pairs, which is crucial for comprehensive analysis .

What strategies can improve the structural characterization of OR8B8?

Structural studies of OR8B8 face challenges common to membrane proteins but can be approached through several methodologies:

Structural TechniqueOptimization StrategiesAdvantages/Limitations
X-ray crystallographyThermostabilizing mutations, fusion partners (e.g., T4 lysozyme), lipidic cubic phaseHigh resolution but challenging for GPCRs
Cryo-electron microscopyAntibody fragment complexes, reconstitution in nanodiscsEmerging method for membrane proteins without crystallization
NMR spectroscopyIsotopic labeling, detergent screening, fragment analysisGood for dynamic studies but size limitations
Computational modelingHomology modeling based on related GPCRs, molecular dynamics simulationsAccessible but requires experimental validation

The use of recombinant OR8B8 with carefully designed constructs facilitates these structural studies. Critical modifications include:

  • Terminal truncations to remove disordered regions

  • Strategic introduction of stabilizing mutations

  • Insertion of crystallization chaperones at ICL3

  • Addition of well-positioned affinity tags for purification

Methodologically, researchers should implement a parallel approach, pursuing computational models while optimizing experimental conditions for structural determination. Recent advances in AlphaFold and related AI prediction tools may provide initial structural insights to guide experimental design.

How can heterologous expression impact the functional characterization of OR8B8?

Different expression systems introduce specific variables that affect OR8B8 functional characterization:

Expression SystemImpact on Functional StudiesMethodological Considerations
Hana3A cellsEnhanced surface expression due to accessory proteinsStandard for initial deorphanization; luciferase assay preferred
HEK293 cellsLower surface expression but well-characterized backgroundMay miss responses detected in other systems
LNCaP cellsDifferent G-protein coupling profileCan detect ligands missed by other systems
Xenopus oocytesElectrophysiological readout via co-expressed channelsGood for detailed characterization of response kinetics

The choice of expression system can dramatically alter experimental outcomes. In a critical methodological finding, researchers demonstrated that new ligands for ORs were successfully identified in human prostate carcinoma cell lines (LNCaP) that were not recognized when the same ORs were expressed in HEK293 cells .

For most comprehensive characterization, researchers should:

  • Express OR8B8 in multiple cellular backgrounds

  • Compare response profiles across different functional assays

  • Validate findings using native olfactory sensory neurons where possible

  • Report detailed experimental conditions to facilitate cross-laboratory comparisons

41% of OR bioassay results in the literature are from luciferase assays using the Hana3A cell line, making this the current gold standard methodology while acknowledging its limitations .

What quality control parameters should be applied to recombinant OR8B8 preparations?

Rigorous quality control is essential for reliable OR8B8 research:

QC ParameterAcceptance CriteriaMethodological Approach
Purity>85% by SDS-PAGECoomassie staining and densitometry analysis
IdentityConfirmed sequenceMass spectrometry peptide mapping
Functional activityDose-dependent ligand responseCalcium flux or cAMP assays with known or predicted ligands
Aggregation stateMonodisperse preparationSize-exclusion chromatography or dynamic light scattering
Endotoxin level<0.1 EU/μg for cell-based assaysLAL or recombinant Factor C assay

Beyond these standard parameters, OR-specific considerations include:

  • Verification of proper membrane incorporation using fractionation studies

  • Confirmation of correct folding via ligand binding capability

  • Assessment of G-protein coupling efficiency in functional assays

Methodologically, researchers should implement a staged QC workflow, beginning with purity and identity confirmation, followed by functional testing appropriate to the intended application, and completed with application-specific validation (e.g., antibody recognition for immunization applications).

How can OR8B8 be optimally reconstituted for functional studies?

Proper reconstitution is critical for maintaining OR8B8 function:

Reconstitution ParameterRecommendationRationale
Initial concentration0.1–1.0 mg/mLPrevents aggregation during rehydration
Reconstitution bufferSterile water or PBSBase solution before additives
Stabilizing additives5–50% glycerolPrevents freeze-damage and maintains solubility
Membrane mimeticsNanodiscs, liposomes, or detergent micellesProvides native-like membrane environment
Reconstitution procedureGentle agitation, avoid vortexingPrevents protein denaturation

For functional studies, the choice of membrane mimetic is particularly important:

  • For binding assays: Detergent micelles (DDM, LMNG) may be sufficient

  • For G-protein coupling: Nanodiscs with appropriate lipid composition

  • For structural studies: Lipid cubic phase systems may be optimal

Methodologically, researchers should allow reconstituted protein to equilibrate at 4°C for at least 1 hour before use in experiments. Critical validation of proper reconstitution includes verification of monodispersity by dynamic light scattering and confirmation of ligand binding capacity .

What approaches can distinguish between OR8B8's role in olfactory versus non-olfactory tissues?

OR8B8 is expressed in both olfactory epithelium and non-olfactory tissues like testes, requiring specialized approaches to differentiate its functions:

MethodologyApplicationKey Considerations
Tissue-specific knockdown/knockoutDetermine phenotypic effectsCRISPR/Cas9 or RNAi with tissue-specific promoters
Differential expression analysisCompare expression levels across tissuesRNA-seq with single-cell resolution
G-protein coupling profilingIdentify signaling pathwaysCompare coupling to Gαolf vs. other G-proteins
Ligand response profilingIdentify tissue-specific agonistsScreen against tissue-relevant compound libraries
In vivo vs. heterologous systemsValidate physiological relevanceCompare native tissue responses to heterologous models

Recent findings suggest ORs may have pleiotropic functions beyond olfaction. In non-olfactory tissues, OR8B8 may couple to different G-proteins and respond to endogenous ligands rather than volatile odorants .

Methodologically, researchers should implement parallel approaches in different tissue types, using tissue-specific reporter systems and validating findings with complementary techniques. Control experiments must account for different cellular backgrounds and potential differences in post-translational modifications between tissues.

How do copy number variations (CNVs) affecting OR8B8 contribute to olfactory phenotypes?

The relationship between OR8B8 genetic variation and olfactory function presents complex research challenges:

CNV EffectResearch ImplicationsMethodological Approaches
Dosage variationPotential impact on odor detection thresholdCorrelate CNV genotypes with psychophysical testing
Deletion allelesLoss of specific odor detection capacityCompare detection thresholds in individuals with/without OR8B8
Multi-OR CNVsCoordinated changes in related OR functionAnalyze CNV patterns across OR subfamilies
Population differencesPotential selective pressures on OR repertoiresCompare CNV frequencies across ancestral populations

Research has revealed that OR genes are particularly susceptible to CNVs, with OR8B8's location on chromosome 11p15.4 being a hotspot for structural variation . High-resolution CNV mapping identified that approximately 50% of OR CNVs involve multiple OR genes, with the largest spanning 11 loci .

Methodologically, researchers should implement comprehensive approaches:

  • Genotype CNVs using high-resolution methods (tiling arrays or targeted sequencing)

  • Correlate genotypes with olfactory phenotypes using standardized psychophysical testing

  • Validate functional effects using in vitro expression systems

  • Compare findings across diverse population groups to identify potential adaptive signatures

What are the most significant contradictions in the OR8B8 literature, and how might they be resolved?

The olfactory receptor field contains several methodological contradictions that affect OR8B8 research:

A critical finding revealed that ligands identified in one cell system (LNCaP) failed to activate the same receptors in another system (HEK293), highlighting the dramatic impact of experimental conditions on results .

Methodologically, researchers should:

  • Implement comprehensive reporting of experimental conditions

  • Validate findings across multiple systems

  • Establish dose-response relationships rather than single-point measurements

  • Consider the M2OR database for standardized comparison of results across studies

OR8B8 research would particularly benefit from a systematic reanalysis of previous findings using standardized methodologies and reporting formats to resolve existing contradictions.

What are the key emerging directions for OR8B8 research?

The field of OR8B8 research is evolving rapidly, with several high-priority directions:

  • Structural biology advances: New techniques like cryo-EM and improved computational models are making OR structure determination more accessible .

  • Comprehensive deorphanization: Systematic screening approaches using the M2OR database framework can accelerate ligand identification .

  • Population genetics: The role of OR8B8 CNVs in human olfactory diversity represents an important evolutionary question .

  • Non-olfactory functions: Investigating OR8B8's expression in testes and other tissues may reveal novel physiological roles .

  • Therapeutic applications: Understanding OR8B8 structure and function may enable targeting for specific medical applications.

Methodologically, the field would benefit from standardized protocols for OR characterization, centralized databases for comparing results across labs, and interdisciplinary approaches combining molecular, cellular, and behavioral techniques to link receptor function to perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.