Recombinant Human Olfactory receptor 8D1 (OR8D1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene location: Chromosome 11q24.2 (GRCh38 coordinates: 124,302,831–124,313,949) .

  • Protein structure:

    • 308 amino acids with seven transmembrane domains .

    • UniProt ID: Q8WZ84; Entrez Gene ID: 283159 .

    • Key residues (e.g., N206 5.46) critical for enantioselective ligand binding .

Production Systems

  • Expression platforms:

    • E. coli (Cusabio, LSBio) .

    • Wheat germ (Thermo Fisher, Bio-Techne) .

  • Purification: N-terminal 10xHis tag for affinity chromatography .

Ligand Binding and Activation

OR8D1 exhibits enantioselectivity for chiral odorants like sotolone:

Parameter(S)-Sotolone(R)-Sotolone
Odor Threshold0.0048 μg/m³0.0514 μg/m³
EC₅₀ (HEK293 assay)84.98 ± 1.05 μmol/L167.20 ± 0.25 μmol/L
Binding StabilityHigher (MD simulations)Lower

Key residues influencing binding: 11 amino acids, including N206 5.46, which stabilizes (S)-sotolone interactions .

Cellular Localization

  • Detected in human spermatozoa flagella and midpiece .

  • Antisense transcripts (OR8D1-as) identified in sperm RNA, suggesting non-coding regulatory roles .

Research Applications

  • Odorant receptor studies: Mapping ligand-receptor interactions using luminescence assays .

  • Structural biology: Cryo-EM and molecular dynamics simulations to resolve activation mechanisms .

  • Reproductive biology: Investigating OR8D1’s role in sperm chemotaxis .

Challenges and Future Directions

  • Structural complexity: Dynamic conformational changes complicate cryo-EM analysis .

  • Ligand diversity: Expanding deorphanization efforts to identify novel OR8D1 agonists/antagonists .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
OR8D1; OR8D3; Olfactory receptor 8D1; OST004; Olfactory receptor 8D3; Olfactory receptor OR11-301; Olfactory receptor-like protein JCG9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8D1
Target Protein Sequence
MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY YFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA LRKVLVGK
Uniprot No.

Target Background

Function

Odorant Receptor (Potential): May be involved in taste perception.

Database Links

HGNC: 8481

KEGG: hsa:283159

STRING: 9606.ENSP00000350474

UniGene: Hs.504211

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the tongue.

Q&A

What is OR8D1 and what is its role in human olfaction?

OR8D1 (Olfactory Receptor Family 8 Subfamily D Member 1) is a protein encoded by the OR8D1 gene in humans. It belongs to the large family of G-protein-coupled receptors (GPCRs) and functions as an odorant receptor. OR8D1 interacts with specific odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception. Like other olfactory receptors, OR8D1 features a characteristic 7-transmembrane domain structure and is responsible for the recognition and G protein-mediated transduction of odorant signals . The olfactory receptor gene family to which OR8D1 belongs is the largest in the human genome, reflecting the complexity of human olfactory perception .

How does the structure of OR8D1 relate to its function?

OR8D1, as a G-protein coupled receptor, contains seven transmembrane domains that form a binding pocket for odorant molecules. The receptor's specific amino acid sequence determines its binding affinity and selectivity for particular odorants. Recent research has identified key amino acid residues, particularly N206 5.46, that are critical for ligand recognition and receptor activation . The receptor's structure enables conformational changes upon odorant binding that activate G-protein signaling cascades, ultimately leading to neuronal depolarization and signal transmission to the olfactory bulb. Molecular dynamics simulations have revealed that the binding pocket of OR8D1 has evolved to discriminate between enantiomers of the same molecule, as demonstrated by its differential response to (R)- and (S)-sotolone .

What odorant compounds are known to activate OR8D1?

Sotolone (4,5-dimethyl-3-hydroxy-2,5-dihydrofuran-2-one) is a well-documented activator of OR8D1, with recent research focusing on the differential activation properties of its enantiomers. The (S)-sotolone enantiomer is a more potent agonist than (R)-sotolone, with EC50 values of 84.98 ± 1.05 and 167.20 ± 0.25 μmol/L, respectively . These enantiomers also produce distinct odor qualities: (R)-sotolone presents smoky, burned, herb, and green aromas, while (S)-sotolone exhibits sweet, milk, acid, and nutty aromas . The odor threshold for (S)-sotolone in air (0.0048 μg/m³) is approximately 10-fold lower than that of (R)-sotolone (0.0514 μg/m³), correlating with its higher potency as an OR8D1 agonist .

What are the most effective systems for recombinant expression of functional OR8D1?

For functional expression of OR8D1, mammalian cell lines—particularly HEK293 cells—have proven most effective. This approach preserves the receptor's native conformation and ensures proper post-translational modifications essential for function. The expression protocol typically involves:

  • Cloning the OR8D1 coding sequence into a mammalian expression vector containing a strong promoter (e.g., CMV)

  • Including epitope tags (e.g., FLAG, Rho) at the N-terminus to facilitate detection and purification

  • Co-expressing accessory proteins such as RTP1S, RTP2, REEP1, or Ric8b to enhance receptor trafficking to the cell membrane

  • Transfecting HEK293 cells using calcium phosphate precipitation or lipid-based transfection reagents

  • Selecting stable transformants using appropriate antibiotics

This system has been successfully employed in luminescence-based functional assays to characterize OR8D1 responses to odorants like sotolone .

How can researchers optimize membrane localization of recombinant OR8D1?

Achieving efficient membrane localization of OR8D1 requires addressing several challenges inherent to olfactory receptor expression:

  • Co-expression with trafficking proteins: Include RTP1S (Receptor Transporting Protein 1 Short), which significantly enhances surface expression by masking retention signals and facilitating ER export.

  • N-terminal modifications: Fusion of the first 20 amino acids of rhodopsin or addition of a leucine-rich signal sequence to the N-terminus of OR8D1 improves trafficking.

  • Codon optimization: Adapting the OR8D1 coding sequence to the codon usage of the expression host enhances translation efficiency.

  • Lower culture temperature: Incubation at 30-32°C instead of 37°C during expression slows protein synthesis and improves folding.

  • Addition of chemical chaperones: Supplementing culture media with compounds like DMSO (1-2%) or sodium butyrate (5-10 mM) can enhance proper folding and membrane trafficking.

Successful membrane localization can be verified through immunocytochemistry or surface biotinylation assays before proceeding to functional studies .

What are the most reliable in vitro assays for measuring OR8D1 activation?

Several complementary approaches provide robust assessment of OR8D1 activation:

  • Cell-based luminescence assays: The most widely used method employs HEK293 cells co-transfected with OR8D1 and a cAMP-responsive luciferase reporter. Upon receptor activation, increased cAMP production activates luciferase expression, generating a quantifiable luminescent signal. This method was successfully used to determine EC50 values for sotolone enantiomers (84.98 ± 1.05 μmol/L for (S)-sotolone and 167.20 ± 0.25 μmol/L for (R)-sotolone) .

  • Calcium imaging: This approach utilizes calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to detect the transient increase in intracellular calcium following OR8D1 activation.

  • BRET/FRET-based assays: These provide real-time monitoring of protein-protein interactions in the signaling cascade following receptor activation.

  • Electrophysiological recordings: Patch-clamp recordings can directly measure electrical currents resulting from OR8D1 activation in expression systems that couple to ion channels.

For comprehensive characterization, dose-response relationships should be established using multiple concentrations of test compounds, with appropriate positive and negative controls .

How can researchers effectively design mutagenesis studies to investigate OR8D1 ligand binding sites?

A systematic approach to OR8D1 mutagenesis includes:

  • In silico analysis: Begin with molecular docking and molecular dynamics simulations to predict amino acid residues likely involved in ligand binding. For OR8D1, this approach successfully identified key residues interacting with sotolone enantiomers .

  • Multiple sequence alignment: Compare OR8D1 with related ORs that have different ligand specificities to identify variable regions likely involved in ligand selectivity.

  • Targeted mutagenesis strategy:

    • Focus on predicted transmembrane domains and extracellular loops

    • Prioritize conserved residues across subfamily members

    • Create conservative mutations (maintaining similar physicochemical properties) and non-conservative mutations

    • Generate alanine-scanning libraries of binding pocket residues

  • Functional validation: Test mutant receptors using luminescence assays with known ligands at multiple concentrations to generate complete dose-response curves.

This approach identified 11 amino acid residues that significantly influence OR8D1 enantioselectivity toward sotolone, with N206 5.46 proving indispensable for activation by (S)-sotolone .

What controls should be included in OR8D1 functional assays?

Robust OR8D1 functional assays require comprehensive controls:

  • Negative controls:

    • Non-transfected cells to assess background signal

    • Cells expressing unrelated olfactory receptors to confirm ligand specificity

    • Vehicle-only treatments to rule out solvent effects

    • Inactive structural analogs of test compounds

  • Positive controls:

    • Known OR8D1 agonists like (S)-sotolone at established EC50 concentrations

    • Direct activation of downstream signaling components (e.g., forskolin for cAMP production)

    • Expression of constitutively active GPCRs

  • Transfection controls:

    • Co-transfection with fluorescent proteins to normalize for transfection efficiency

    • Western blot analysis to confirm comparable receptor expression levels

    • Surface expression assays to verify membrane localization

  • Data normalization:

    • Report responses as percentage of maximum response to reference agonist

    • Include full dose-response curves rather than single-point measurements

    • Present EC50 values with standard errors from multiple independent experiments

These controls ensure that observed responses are specific to OR8D1 activation rather than experimental artifacts .

How do the binding mechanisms differ between (R)- and (S)-sotolone enantiomers with OR8D1?

The differential activation of OR8D1 by sotolone enantiomers reveals sophisticated molecular recognition mechanisms:

Property(R)-Sotolone(S)-SotoloneSignificance
EC50 value167.20 ± 0.25 μmol/L84.98 ± 1.05 μmol/L(S)-form is ~2× more potent
Odor threshold0.0514 μg/m³0.0048 μg/m³(S)-form has ~10× lower threshold
Odor qualitySmoky, burned, herb, greenSweet, milk, acid, nuttyDistinct perceptual profiles
Binding stabilityLowerHigherExplains potency difference

Molecular dynamics simulations and molecular mechanics Poisson-Boltzmann surface area analyses revealed that the (S)-sotolone-OR8D1 complex forms more stable hydrogen bonds and hydrophobic interactions than the (R)-sotolone complex . The lactone oxygen of (S)-sotolone forms a critical hydrogen bond with N206 5.46, which is absent or weaker in the (R)-enantiomer binding. Additionally, the methyl group at position 5 of (S)-sotolone fits optimally into a hydrophobic pocket formed by transmembrane domains 3, 5, and 6, while the same group in (R)-sotolone experiences steric hindrance. These structural differences explain both the greater potency of (S)-sotolone and its distinct odor profile .

What is the significance of N206 5.46 in OR8D1 activation by sotolone enantiomers?

N206 5.46 represents a critical activation determinant for OR8D1:

  • Structural position: Located in transmembrane domain 5 (TM5), N206 5.46 extends into the binding pocket where it can directly interact with ligands.

  • Mutagenesis evidence: Site-directed mutagenesis studies demonstrated that mutation of N206 5.46 to alanine completely abolished OR8D1 activation by (S)-sotolone, while only reducing activation by (R)-sotolone .

  • Molecular interaction: Molecular dynamics simulations revealed that N206 5.46 forms a crucial hydrogen bond with the lactone oxygen of (S)-sotolone, stabilizing the ligand-receptor complex .

  • Evolutionary conservation: Multiple sequence alignment showed that position 5.46 is highly conserved among olfactory receptors responsive to similarly structured odorants.

  • Activation mechanism: The N206 5.46-ligand interaction likely triggers a conformational change in TM5 that propagates to the intracellular domains, enabling G-protein coupling and downstream signaling.

This residue therefore represents a molecular switch that confers enantioselectivity to OR8D1, explaining the observed differences in potency and odor quality between sotolone enantiomers .

How can computational methods enhance understanding of OR8D1 ligand interactions?

Computational approaches provide powerful insights into OR8D1-ligand interactions that complement experimental data:

  • Homology modeling: Since crystal structures of ORs remain challenging to obtain, homology models based on related GPCRs with resolved structures (e.g., rhodopsin, β-adrenergic receptors) serve as critical starting points. These models can predict the three-dimensional arrangement of OR8D1's transmembrane helices and binding pocket residues.

  • Molecular docking: Automated docking algorithms can predict favorable binding orientations of ligands within the OR8D1 binding pocket. For sotolone enantiomers, docking studies correctly predicted the higher binding affinity of (S)-sotolone and identified key interacting residues .

  • Molecular dynamics simulations: These provide time-evolution of ligand-receptor complexes, revealing:

    • Stability of binding interactions over nanosecond timescales

    • Conformational changes in receptor structure upon ligand binding

    • Water-mediated hydrogen bonding networks

    • Entropic and enthalpic contributions to binding energy

  • MM-PBSA calculations: Molecular mechanics Poisson-Boltzmann surface area analysis quantifies binding energetics, confirming that the (S)-sotolone-OR8D1 complex (-25.48 kcal/mol) is energetically more favorable than the (R)-sotolone complex (-20.12 kcal/mol) .

  • Virtual screening: Computational methods can screen large compound libraries to identify novel OR8D1 ligands with desired properties, accelerating experimental discovery.

These computational approaches have successfully explained the molecular basis for enantioselective recognition of sotolone by OR8D1 and can guide rational design of new odorants with predicted receptor activities .

What are the main challenges in crystallizing OR8D1 for structural studies?

Obtaining crystal structures of OR8D1 presents several formidable challenges:

  • Inherent flexibility: Like other GPCRs, OR8D1 exhibits conformational heterogeneity, transitioning between inactive and active states, which hinders crystallization.

  • Membrane protein limitations: The amphipathic nature of OR8D1 requires detergents or lipidic environments for stability, complicating crystallization conditions.

  • Expression obstacles:

    • Low natural expression levels necessitate recombinant systems

    • Potential toxicity to expression hosts

    • Improper folding and aggregation tendency

    • Poor trafficking to cell membranes

  • Purification challenges:

    • Maintaining native conformation during solubilization

    • Achieving sufficient purity and homogeneity

    • Preventing oligomerization

    • Stabilizing the receptor during concentration steps

  • Crystallization barriers:

    • Finding compatible detergents that maintain function while allowing crystal contacts

    • Identifying stabilizing ligands to reduce conformational heterogeneity

    • Engineering constructs with reduced flexibility (e.g., T4 lysozyme fusion)

    • Developing appropriate crystallization screens specific for olfactory receptors

Alternative approaches such as cryo-electron microscopy (cryo-EM) and nuclear magnetic resonance (NMR) spectroscopy may provide structural insights without requiring crystallization, though each has its own technical limitations for membrane proteins like OR8D1.

How can isotope labeling techniques be applied to study OR8D1-ligand interactions?

Isotope labeling provides powerful approaches for investigating OR8D1-ligand interactions at the atomic level:

  • Ligand-based NMR studies:

    • Synthesizing 13C/15N-labeled sotolone enantiomers

    • Saturation transfer difference (STD) NMR to map ligand epitopes in contact with OR8D1

    • Transfer NOE experiments to determine bound conformation of flexible ligands

    • 19F-labeled ligand analogs for higher sensitivity detection

  • Receptor labeling strategies:

    • Selective 15N-labeling of lysine, arginine or histidine residues in OR8D1

    • Site-specific incorporation of 19F-labeled amino acids at positions predicted to be near the binding site

    • TROSY-based experiments to overcome size limitations of receptor-detergent complexes

    • Methyl-TROSY approaches focusing on labeled methyl groups in isoleucine, leucine and valine residues

  • Photo-crosslinking approaches:

    • Incorporation of photo-reactive amino acids (e.g., p-benzoyl-phenylalanine) at predicted binding site positions

    • Synthesis of photoactivatable sotolone derivatives containing benzophenone or diazirine groups

    • Mass spectrometric analysis of crosslinked peptides to identify binding site residues

  • Hydrogen-deuterium exchange mass spectrometry:

    • Comparing deuterium uptake rates in free vs. ligand-bound OR8D1

    • Identifying regions with altered solvent accessibility upon ligand binding

    • Providing information about conformational changes induced by different enantiomers

These techniques complement computational and mutagenesis approaches, providing direct experimental evidence for specific atomic interactions between OR8D1 and its ligands.

What approaches can address the low expression levels typical of recombinant olfactory receptors like OR8D1?

Overcoming expression challenges requires multi-faceted strategies:

  • Vector engineering:

    • Use of strong, inducible promoters (e.g., TRE, T7)

    • Inclusion of enhancer elements and optimized Kozak sequences

    • Incorporation of RNA stabilizing elements (e.g., WPRE)

    • Codon optimization for expression host

  • Fusion strategies:

    • N-terminal fusions with well-expressed proteins (e.g., maltose-binding protein)

    • Addition of rhodopsin-derived N-terminal tags

    • T4 lysozyme insertion in intracellular loop 3

    • C-terminal GFP fusion for expression monitoring

  • Cell line selection:

    • Evaluation of multiple mammalian cell lines (HEK293, CHO, Sf9)

    • Development of stable cell lines with integrated receptor genes

    • Use of inducible expression systems to minimize toxicity

    • Adaptation to suspension culture for scale-up

  • Culture optimization:

    • Temperature reduction during expression phase (30-32°C)

    • Addition of chemical chaperones (DMSO, glycerol, trimethylamine N-oxide)

    • Supplementation with ligands during expression

    • Controlled induction protocols with optimized timing and inducer concentration

  • Trafficking enhancement:

    • Co-expression with RTP1S, RTP2, REEP1, and Ric8b

    • Addition of export signal sequences

    • Treatment with histone deacetylase inhibitors (sodium butyrate, valproic acid)

    • Golgi-export enhancing compounds

Implementing combinations of these approaches has achieved functional expression levels sufficient for biochemical and pharmacological characterization of OR8D1 in research settings .

How might OR8D1 ligand discovery inform food science and flavor chemistry?

The enantioselective recognition of sotolone by OR8D1 has significant implications for food science:

  • Flavor compound optimization: Understanding the molecular basis of OR8D1 activation can guide the development of modified sotolone derivatives with enhanced potency or altered sensory profiles. The distinct odor qualities of sotolone enantiomers (smoky/burned vs. sweet/nutty) demonstrate how subtle structural changes affect perception .

  • Food processing impacts: Research can investigate how cooking, fermentation, and aging processes affect the enantiomeric ratios of sotolone in foods, potentially explaining why certain processing methods enhance desirable or undesirable aromas.

  • Structure-odor relationships: The established link between molecular structure and receptor activation provides a mechanistic foundation for rational design of new flavor compounds with predicted sensory properties, moving beyond traditional trial-and-error approaches.

  • Flavor synergism: Investigating how sotolone and related compounds interact with multiple olfactory receptors, including OR8D1, could explain synergistic effects observed in complex food matrices.

  • Sensory evaluation correlation: Connecting molecular activation patterns of OR8D1 with human sensory panel data can establish predictive models for how chemical modifications translate to perceptual changes.

This research exemplifies how molecular-level understanding of olfactory reception can transform approaches to flavor creation and food product development .

What is the potential for developing high-throughput screening assays to identify novel OR8D1 ligands?

Advanced screening platforms for OR8D1 ligand discovery could include:

  • Cell-based reporter systems:

    • Development of stable cell lines co-expressing OR8D1 and luciferase reporters

    • Adaptation to 384- or 1536-well format for miniaturized screening

    • Implementation of automated liquid handling and detection systems

    • Integration of cryopreserved ready-to-use cells to improve reproducibility

  • Biosensor technologies:

    • BRET-based sensors that directly report conformational changes in OR8D1

    • FRET-based calcium sensors for real-time activation measurement

    • Label-free detection systems (e.g., dynamic mass redistribution)

    • Impedance-based cellular assays for integrated response measurement

  • Multiplexed screening approaches:

    • Parallel testing against panels of olfactory receptors including OR8D1

    • Barcoded cell populations expressing different receptor variants

    • Machine learning algorithms to correlate chemical structures with activation profiles

    • Virtual screening validated by targeted biochemical assays

  • Microfluidic platforms:

    • Droplet-based encapsulation of OR8D1-expressing cells

    • Gradient generators for dose-response analysis

    • Integration with mass spectrometry for direct compound identification

    • Single-cell resolution detection of OR8D1 activation

These approaches would facilitate the discovery of novel OR8D1 ligands beyond sotolone, potentially identifying compounds with improved potency, selectivity, or physicochemical properties for research and practical applications.

How might advances in structural biology techniques impact future OR8D1 research?

Emerging structural biology approaches promise to revolutionize OR8D1 research:

These structural insights would provide atomic-level understanding of the mechanisms underlying OR8D1's enantioselectivity and could guide structure-based design of novel agonists and antagonists with precisely engineered properties .

What are the key biosafety considerations when working with recombinant OR8D1?

Laboratory work with recombinant OR8D1 requires adherence to established biosafety practices:

  • Risk assessment:

    • Recombinant OR8D1 expression generally falls under Biosafety Level 1 (BSL-1) containment

    • Work with viral vectors for gene delivery may require BSL-2 procedures

    • Standard laboratory practices adequate for most research applications

    • No evidence of toxicity or pathogenicity from the receptor protein itself

  • Laboratory protocols:

    • Standard microbiological practices (hand washing, no eating/drinking)

    • Personal protective equipment (lab coat, gloves, eye protection)

    • Proper waste handling and decontamination

    • Biosafety cabinet use when generating aerosols or working with viral vectors

  • Storage and transportation:

    • Secure storage of recombinant materials

    • Proper labeling of all samples and constructs

    • Compliance with shipping regulations for biological materials

    • Material transfer agreements when sharing between institutions

  • Documentation requirements:

    • Institutional Biosafety Committee approval where required

    • Detailed protocols and safety data sheets

    • Training records for all personnel

    • Incident reporting procedures

While OR8D1 research poses minimal inherent biological risk, adherence to good laboratory practice and institutional biosafety guidelines remains essential for responsible research conduct.

What intellectual property considerations apply to novel OR8D1 ligands and applications?

Researchers should be aware of several intellectual property dimensions:

  • Patent landscape:

    • Existing patents may cover specific uses of sotolone enantiomers

    • Novel OR8D1 ligands with unique structures may be patentable

    • Methods for producing, purifying, or detecting specific OR8D1 agonists could constitute patentable innovations

    • Therapeutic applications targeting OR8D1 may have distinct patent protection

  • Research exemptions:

    • Many jurisdictions provide exemptions for non-commercial research use

    • Material transfer agreements may restrict commercial development

    • Clear documentation of when innovations occurred is essential

  • Collaborative considerations:

    • Joint research agreements should address IP ownership in advance

    • Academic-industry partnerships require careful IP planning

    • Publication timing relative to patent filing is strategic

    • Open science initiatives may conflict with commercialization goals

  • Application-specific issues:

    • Flavor and fragrance applications may be protected by trade secrets rather than patents

    • Diagnostic applications using OR8D1 have distinct regulatory and IP considerations

    • Research tools involving OR8D1 may have specialized licensing models

Researchers should consult institutional technology transfer offices early in the development process to navigate these complex considerations effectively.

How can researchers address non-specific activation in OR8D1 functional assays?

Non-specific activation presents a significant challenge in OR8D1 assays. Systematic troubleshooting includes:

  • Source identification:

    • Test compounds on non-transfected cells to identify direct effects on reporter systems

    • Evaluate activation of unrelated olfactory receptors to detect promiscuous compounds

    • Investigate solvent effects by testing vehicle alone at equivalent concentrations

    • Consider compound autofluorescence or luminescence interference

  • Assay optimization:

    • Adjust cell density to improve signal-to-noise ratio

    • Optimize transfection conditions to increase specific signal

    • Modify incubation times to capture optimal activation window

    • Adjust reagent concentrations in detection system

  • Control implementation:

    • Include dose-response curves for known specific agonists

    • Incorporate negative control receptors in parallel assays

    • Use receptor-inactive structural analogs as negative controls

    • Implement appropriate statistical analysis with replicate measurements

  • Compound handling:

    • Verify compound purity through analytical methods

    • Test for potential degradation products

    • Ensure complete solubilization without precipitation

    • Use serial dilutions from concentrated stocks made fresh

  • Data analysis refinement:

    • Implement robust normalization methods

    • Subtract baseline/vehicle response

    • Consider alternative curve-fitting models

    • Perform replicate experiments on different days

These approaches can significantly improve the reliability and specificity of OR8D1 functional assays, yielding more accurate and reproducible results .

What strategies can overcome expression difficulties when working with OR8D1 mutants?

Mutant OR8D1 variants often exhibit expression challenges beyond those of the wild-type receptor. Effective strategies include:

  • Mutation design refinement:

    • Consider using conservative substitutions first (e.g., Leu→Ile rather than Leu→Ala)

    • Avoid mutations in residues critical for protein folding

    • Design compensatory mutations that maintain structural integrity

    • Implement stabilizing mutations from related GPCRs

  • Expression vector modifications:

    • Incorporate stronger signal sequences

    • Use inducible promoters with titratable expression

    • Include chaperone-binding motifs

    • Add RNA stabilizing elements

  • Co-expression approaches:

    • Increase ratio of trafficking proteins (RTP1S, REEP1)

    • Add chemical chaperones to culture media

    • Co-express Hsc70 or other molecular chaperones

    • Implement temperature-shift protocols (37°C→30°C)

  • Detection optimization:

    • Use high-sensitivity antibodies for detection

    • Implement signal amplification methods

    • Increase cell numbers for biochemical assays

    • Concentrate samples when possible

  • Alternative model systems:

    • Consider yeast expression systems as alternatives

    • Evaluate insect cell expression for problematic mutants

    • Test cell-free expression systems

    • Develop nanodiscs or proteoliposome reconstitution

Successful expression of challenging OR8D1 mutants often requires multiple optimization steps, but yields valuable structure-function insights, as demonstrated in studies identifying critical residues for sotolone enantiomer recognition .

How might single-cell transcriptomics advance understanding of OR8D1 expression patterns?

Single-cell RNA sequencing technologies offer unprecedented insights into OR8D1 biology:

  • Expression heterogeneity mapping:

    • Identification of specific olfactory sensory neuron (OSN) subpopulations expressing OR8D1

    • Quantification of expression levels across individual cells

    • Correlation with developmental stage and spatial position in the olfactory epithelium

    • Association with co-expressed genes in the same cells

  • Methodological approaches:

    • Droplet-based single-cell RNA-seq of dissociated olfactory epithelium

    • Spatial transcriptomics preserving anatomical context

    • Single-nucleus RNA-seq for challenging tissue samples

    • CITE-seq combining transcriptome and surface protein analysis

  • Developmental trajectory analysis:

    • Reconstruction of OSN differentiation pathways

    • Temporal dynamics of OR8D1 expression onset

    • Regulatory factors controlling receptor choice

    • Cell fate decisions in OR8D1-expressing neurons

  • Comparative transcriptomics:

    • Cross-species comparison of OR8D1 expression patterns

    • Correlation with behavioral responses to sotolone

    • Disease-related alterations in receptor expression

    • Age-dependent changes in the OR8D1-expressing cell population

These approaches would advance fundamental understanding of the biological context in which OR8D1 functions and potentially reveal new applications in sensory biology and flavor science.

What are the prospects for developing OR8D1-based biosensors for detecting sotolone in food samples?

Development of OR8D1-based biosensors represents an exciting translational application:

  • Sensing platform options:

    • Cell-based biosensors with OR8D1-expressing cells and integrated reporters

    • Cell-free systems with purified receptor components

    • Nanodisc-incorporated OR8D1 coupled to electrical or optical detection

    • Aptamer-based sensors mimicking OR8D1 binding pocket

  • Detection technologies:

    • Bioluminescence resonance energy transfer (BRET)

    • Surface plasmon resonance (SPR)

    • Field-effect transistor (FET)-based detection

    • Impedance measurements of receptor-expressing cells

  • Practical applications:

    • Quality control in food manufacturing

    • Authentication of aged products (wines, spirits, vinegars)

    • Detection of spoilage markers in dairy products

    • Monitoring fermentation processes

  • Advantages over conventional methods:

    • Potential for higher sensitivity matching human perception thresholds

    • Enantioselective detection not easily achieved by chemical methods

    • Direct correlation with sensory properties

    • Potential for miniaturization and field deployment

  • Development challenges:

    • Ensuring receptor stability in sensing environments

    • Addressing matrix effects in complex food samples

    • Achieving reproducibility and calibration stability

    • Meeting regulatory requirements for analytical methods

With demonstrated sensitivity to sotolone in the nanomolar range , OR8D1-based biosensors could provide valuable tools for food science applications, particularly where enantioselective detection is important.

How can CRISPR gene editing technologies advance OR8D1 research?

CRISPR-based approaches offer transformative tools for OR8D1 research:

  • Knock-in models:

    • Generation of humanized mouse models expressing human OR8D1

    • Introduction of reporter genes under endogenous OR8D1 control

    • Creation of tagged receptor variants at endogenous loci

    • Development of conditional expression systems

  • Functional genomics:

    • CRISPR interference (CRISPRi) to modulate OR8D1 expression

    • CRISPR activation (CRISPRa) to upregulate OR8D1 in model systems

    • Pooled CRISPR screens to identify factors affecting OR8D1 trafficking

    • Base editing to introduce specific mutations without double-strand breaks

  • Regulatory element mapping:

    • CRISPR tiling screens of non-coding regions controlling OR8D1 expression

    • Identification of enhancers and silencers regulating receptor choice

    • Investigation of epigenetic mechanisms in OR singularity

    • Mapping of transcription factor binding sites

  • Advanced applications:

    • Prime editing for precise introduction of clinically relevant variants

    • Optical control of OR8D1 expression using light-activated CRISPR systems

    • In vivo editing to study OR8D1 function in intact organisms

    • Simultaneous modification of OR8D1 and associated signaling components

These approaches would significantly advance understanding of OR8D1 biology beyond what is possible with traditional overexpression systems, potentially revealing new aspects of olfactory receptor function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.