Recombinant Human Olfactory receptor 8G1 (OR8G1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Human Olfactory Receptor 8G1 (OR8G1) is a synthetic version of the OR8G1 gene product, a G-protein-coupled receptor (GPCR) specialized in detecting odorant molecules. It belongs to the largest gene family in the human genome, with ~400 functional olfactory receptors (ORs) that mediate sensory perception of smells . OR8G1 is encoded by the OR8G1 gene (locus 11q24.2) and exists as a pseudogene in some individuals due to early stop codons or deletions .

PropertyDetail
Gene NameOR8G1 (aliases: OR8G1P, TPCR25, HSTPCR25)
Protein AccessionUniProt: Q15617
Structure7-transmembrane domains; integral to plasma membrane
FunctionOdorant binding; G-protein-mediated signaling

Genetic Variability

Copy-number variation (CNV) and single-nucleotide polymorphisms (SNPs) influence OR8G1 functionality:

  • CNV Impact: Segmental duplications in genomic regions housing ORs contribute to population-level variation in odor perception .

  • Pseudogenization: Some alleles lack functional OR8G1 due to premature stop codons (e.g., rs3898634) .

Expression Systems

OR8G1 is produced via heterologous expression in:

SystemHostTagPurityYield
E. coliBacterialHis-tag≥85% (SDS-PAGE)0.02–0.1 mg/vial
Cell-FreeIn vitroNoneVariableN/A

Key Challenges:

  • Low Solubility: Requires detergents (e.g., n-dodecyl-β-D-maltoside) for membrane extraction .

  • Conformational Stability: Purified OR8G1 exists as monomers and dimers, confirmed via size-exclusion chromatography and multi-angle light scattering .

Functional Studies

OR8G1 is used to investigate odorant-binding specificity and G-protein signaling:

  • Ligand Screening: Fluorescence assays (e.g., tryptophan fluorescence quenching) identify odorant affinities in the micromolar range .

  • CNV Analysis: MLPA/PCR assays detect copy-number variations in human populations, linking genetic diversity to olfactory perception .

Biochemical Assays

  • cAMP Assay: Measures G-protein activation via real-time luminescence .

  • Fluorescence Binding: Quantifies odorant-receptor interactions using intrinsic tryptophan residues .

Current Limitations and Future Directions

  • Low Functional Annotation: OR8G1 lacks known ligands or therapeutic targets .

  • Heterologous Expression Challenges: Poor yields and instability hinder structural studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8G1; OR8G1P; Olfactory receptor 8G1; Olfactory receptor OR11-281; Olfactory receptor TPCR25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8G1
Target Protein Sequence
MSGENNSSVTEFILAGLSEQPELQLPLFLLFLGIYVVTVVGNLGMTTLIWLSSHLHTPMY YFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY DRYMAICSPLLYSVIISNKACFSLILGVYIIGLVCASVHTGCMFRVQFCKFDLINHYFCD LLPLLKLSCSSIYVNKLLILCVGAFNILVPSLTILCSYIFIIASILHIRSTEGRSKAFST CSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVHVS LKKMLQRRTLL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8484

KEGG: hsa:26494

UniGene: Hs.448172

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of OR8G1?

OR8G1 (also known as OR8G1P, TPCR25, HSTPCR25, and Olfactory receptor OR11-281) belongs to the G-protein coupled receptor 1 family, featuring a characteristic 7-transmembrane domain structure that is common among neurotransmitter and hormone receptors . As a member of the olfactory receptor family 8, subfamily G, the protein consists of 311 amino acids with a molecular weight of approximately 35 kDa . OR8G1 shares this transmembrane structure with other olfactory receptors, which enables the recognition and G protein-mediated transduction of odorant signals in the nose . This receptor arises from a single coding-exon gene and is responsible for initiating neuronal responses that trigger smell perception .

What is the genetic status of OR8G1 in human populations?

OR8G1 represents a polymorphic pseudogene within the human genome, demonstrating significant variation across individuals . Some individuals possess a functional allele that encodes a full-length, potentially active protein, while others carry a non-functional allele due to the presence of an early stop codon and a 3' end deletion . This genetic polymorphism is part of a broader pattern of copy number variation (CNV) observed within the olfactory receptor gene family, which may contribute to differences in olfactory perception among humans . The OR8G1 gene is located at chromosomal position 11q24.2, according to genomic mapping studies .

What recombinant protein options are available for OR8G1 research?

Researchers can access several types of recombinant OR8G1 proteins for experimental applications. Full-length human OR8G1 with His-tags expressed in E. coli systems provides complete protein structure for functional studies . Cell-free expression systems are also employed to produce recombinant transmembrane OR8G1 proteins, which may better preserve native protein conformation . The availability of these recombinant proteins facilitates both structural and functional studies of OR8G1. When selecting a recombinant protein for research, investigators should consider the expression system, protein tags, and purification methods based on their specific experimental requirements and downstream applications.

What antibodies and detection methods are available for OR8G1 research?

Several antibodies have been developed for OR8G1 research, including rabbit polyclonal antibodies suitable for multiple applications . These antibodies are typically generated against synthesized peptides derived from specific regions of human OR8G1, such as the amino acid range 262-311 . Available detection methods include Enzyme-Linked Immunosorbent Assay (ELISA), Western Blotting (WB), and Immunofluorescence (IF) . ELISA kits for human OR8G1 provide quantitative measurement capabilities with detection ranges of approximately 0.156-10 ng/ml, suitable for analyzing OR8G1 in tissue homogenates, cell lysates, and other biological fluids . When selecting antibodies, researchers should consider factors such as host species, clonality, and validated applications to ensure compatibility with their experimental design.

How can copy number variation of OR8G1 be effectively assessed in experimental settings?

Copy number variation (CNV) of OR8G1 can be assessed using multiple complementary techniques that provide both high-throughput screening and targeted validation. Multiplex Ligation-dependent Probe Amplification (MLPA) combined with PCR represents an effective approach for assaying OR8G1 copy number, as demonstrated in studies examining CNVs across the olfactory receptor family . This methodology allows researchers to precisely determine OR8G1 copy numbers across different individuals or populations. For broader, genome-wide assessment, computational approaches using whole-genome sequencing data can identify potential CNVs, though these should be experimentally validated due to the high rate of false positives in reported CNV intervals . Advanced techniques like digital droplet PCR (ddPCR) may provide improved precision for absolute quantification of copy numbers. When interpreting results, researchers should be aware that CNV assessment in segmentally duplicated regions (where many ORs reside) presents particular technical challenges due to sequence similarities.

What mechanisms underlie the genetic variation observed in OR8G1?

The genetic variation in OR8G1 results from multiple molecular mechanisms, including both homology-based and homology-independent processes that have contributed to remodeling the OR gene family . Non-allelic homologous recombination (NAHR) within ORs can create hybrid genes, as observed in related olfactory receptors, while NAHR outside ORs can lead to complete gene deletions . Additionally, non-homologous end joining (NHEJ) can result in complex alternative structures involving multiple deletions and inversions . The enrichment of ORs in copy-number variable regions appears to be primarily due to their prevalence in segmentally duplicated genomic regions rather than positive selection . Further research examining the specific mechanisms affecting OR8G1 would require detailed characterization of breakpoints in individuals carrying different structural variants, potentially utilizing long-read sequencing technologies to resolve complex genomic architectures.

How can ligand binding and activation profiles for OR8G1 be characterized?

Characterizing ligand binding and activation profiles for OR8G1 requires multi-faceted approaches due to the challenges inherent in working with olfactory receptors. High-throughput screening methods can identify potential odorant ligands from chemical libraries, followed by dose-response assays to determine EC50 values. In heterologous expression systems, calcium imaging using fluorescent indicators provides real-time visualization of receptor activation, while FLIPR (Fluorometric Imaging Plate Reader) assays enable higher throughput screening. For direct binding assessment, competitive binding assays using radiolabeled or fluorescently labeled ligands can determine binding affinities, though these require prior knowledge of at least one high-affinity ligand. Advanced biophysical methods such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) using purified recombinant OR8G1 can provide detailed binding kinetics. Computational approaches including molecular docking and molecular dynamics simulations can complement experimental data to predict binding modes and structure-activity relationships.

What are the implications of OR8G1 polymorphism for individual olfactory perception?

The polymorphic nature of OR8G1, with some individuals carrying functional alleles and others non-functional variants, likely contributes to phenotypic variation in human olfactory perception . This genetic variation may influence sensitivity to specific odorants that interact with OR8G1, potentially affecting detection thresholds, perceived intensity, or quality perception of certain scents. To investigate these relationships, researchers can employ genotype-phenotype association studies that correlate OR8G1 variants with performance on standardized olfactory tests. These studies should include precise genotyping of functional versus non-functional alleles, copy number determination, and comprehensive psychophysical testing with odorants likely to activate OR8G1. Complementary functional studies in vitro using recombinant receptors can validate differential responses of variant forms to candidate ligands. Understanding these relationships may have implications beyond basic science, potentially informing personalized approaches to conditions involving olfactory dysfunction or hypersensitivity.

What quality control measures should be implemented when working with recombinant OR8G1?

Rigorous quality control is essential when working with recombinant OR8G1 due to its challenging biochemical properties as a transmembrane protein. Protein purity should be assessed using SDS-PAGE and Western blotting with OR8G1-specific antibodies to confirm identity and molecular weight (approximately 35 kDa) . Mass spectrometry can provide additional verification of protein identity and post-translational modifications. For functional studies, proper folding and membrane insertion are critical considerations that can be evaluated using circular dichroism spectroscopy or limited proteolysis assays. When working with cell-based systems, surface expression should be confirmed using immunofluorescence or flow cytometry with non-permeabilized cells. Researchers should also validate protein activity using functional assays such as GTPγS binding or second messenger production in response to known ligands. For long-term studies, protein stability under storage conditions should be monitored, with recombinant OR8G1 typically stored at -20°C with minimal freeze-thaw cycles to maintain integrity .

How can researchers address the challenges of OR8G1's low expression levels in native tissues?

Studying OR8G1 in its native context presents challenges due to the selective expression of olfactory receptors, with each olfactory neuron typically expressing only one OR allele . To overcome low expression levels, researchers can employ targeted enrichment strategies including laser capture microdissection of OR8G1-expressing neurons identified through in situ hybridization or immunohistochemistry. Single-cell RNA sequencing of olfactory epithelium provides another approach to identify and characterize OR8G1-expressing neurons without prior selection. For protein detection in native tissues, signal amplification methods such as tyramide signal amplification (TSA) or proximity ligation assays (PLA) can enhance sensitivity of immunodetection. Development of OR8G1-specific antibodies with high affinity and specificity is crucial, potentially using the C-terminal region (amino acids 262-311) as immunogen, which has proven effective for antibody generation . Additionally, transgenic reporter systems in model organisms using the OR8G1 promoter to drive fluorescent protein expression can facilitate visualization and isolation of OR8G1-expressing cells.

What bioinformatic approaches can advance OR8G1 research?

Bioinformatic analyses provide valuable tools for advancing OR8G1 research across multiple dimensions. Comparative genomic analyses across species can reveal evolutionary patterns and conserved functional residues within OR8G1, potentially identifying critical domains for ligand binding or signal transduction. Protein structure prediction using techniques like AlphaFold2 can generate structural models of OR8G1 for in silico ligand screening and binding site analysis, despite the historical challenges of crystallizing GPCRs. Transcriptomic data mining from olfactory epithelium datasets can identify co-expressed genes that may function in OR8G1 signaling pathways or regulation. Analysis of OR8G1 promoter regions can reveal transcription factor binding sites controlling its expression, while investigation of non-coding variants may uncover regulatory elements affecting OR8G1 expression levels. Network analyses integrating protein-protein interaction data can place OR8G1 within broader signaling contexts. When conducting these analyses, researchers should consider the polymorphic nature of OR8G1 and incorporate variant data to understand functional differences between alleles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.