Recombinant Human Olfactory receptor 8G2 (OR8G2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant OR8G2 is a laboratory-engineered form of the olfactory receptor 8G2, expressed in heterologous systems like E. coli . As a class A GPCR, it features seven transmembrane domains and is involved in odorant binding and signal transduction . OR8G2 is part of the largest multigene family in vertebrates, with humans possessing ~400 functional OR genes .

Key Features

  • UniProt ID: Q15614

  • Amino Acid Sequence: Partial or full-length sequences (e.g., residues 1–310) are expressed, depending on the recombinant variant .

  • Molecular Weight: ~34.5 kDa (theoretical) .

  • Structure: Shares conserved motifs with class A GPCRs, including a ligand-binding pocket within transmembrane helices .

Functional Domains

  • Ligand-binding region: Binds odorants via hydrophobic interactions .

  • G-protein coupling domain: Activates adenylate cyclase pathways upon ligand binding .

Production and Purification

Recombinant OR8G2 is typically produced using E. coli expression systems, followed by affinity chromatography for purification .

ParameterDetails
Expression SystemE. coli (in vitro)
Purity>85% (SDS-PAGE)
TagN-terminal 10xHis-tag (common)
Storage-20°C to -80°C in PBS with 50% glycerol and 0.5% BSA

Research Applications

Recombinant OR8G2 is critical for:

  • Odorant Screening: Identifying ligands via luciferase-based assays .

  • Structural Studies: Resolving 3D conformations to understand ligand-binding mechanisms .

  • Functional Genomics: Studying genetic variations impacting odor perception .

  • Disease Research: Investigating OR8G2’s roles in non-olfactory tissues (e.g., brain, pancreas) .

Functional Insights from Studies

  • Odorant Specificity: OR8G2 responds to multiple odorants, exhibiting combinatorial coding patterns .

  • Trafficking Dependence: Requires chaperones like RTP1/2 for cell surface expression in heterologous systems .

  • Genetic Variants: Polymorphisms in OR8G2 may alter odor perception thresholds .

Challenges and Future Directions

  • Ligand Identification: Only ~6% of OR-odorant pairs are characterized, necessitating high-throughput screening .

  • Structural Resolution: OR8G2’s full 3D structure remains unresolved, limiting drug discovery .

  • Assay Optimization: Heterologous expression systems often require co-factors (e.g., RTPs) for functional studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Target Names
OR8G2
Target Protein Sequence
MDPGNHSSVTESILAGLSEQPELQLRLFLLFLGICVVTVVGNLGMITLIGLSSHLHTPMY YFLSSLSFIDFCHSTVITPKMLVNFATEKNIISYPECMAQLYLFSIFAIAECHMLAAMAY DCYVAICSPLLYNVIMSYHHCFWLTVGVYILGILGSTIHTSFMLRLFLCKTNVINHYFCD LFPLLGLSCSSTYINELLVLVLSAFNILMPALTILASYIFIIASILRIHSTEGRSKAFST CSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNPLIYSLRNKDVKLA VKKILHQTAC
Uniprot No.

Q&A

How does the function of OR8G2 compare to other olfactory receptors?

OR8G2 functions similarly to other olfactory receptors through ligand-binding induced conformational changes that activate downstream signaling pathways. While the specific odorant molecules that activate OR8G2 have not been comprehensively characterized in the provided research, the general mechanism involves:

  • Odorant binding in a pocket formed by the transmembrane domains

  • Conformational changes in the receptor structure, particularly in Extracellular Loop 3 (ECL3)

  • Activation of associated G-proteins

  • Initiation of intracellular signaling cascades

Recent studies of other olfactory receptors have shown that structural alterations in ECL3 induced by odorant molecules can trigger receptor activation. For example, the human olfactory receptor OR51E2 is activated by the fatty acid propionate, suggesting that OR8G2 might similarly respond to specific molecular ligands through conformational changes in its extracellular loops .

What expression systems are most effective for producing recombinant OR8G2?

Based on current research protocols, E. coli has been successfully employed as an expression system for recombinant OR8G2 protein production. When expressing GPCRs like OR8G2, several methodological considerations are critical:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential improper foldingInitial structural studies, antibody production
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingHigher cost, lower yield, longer production timeFunctional studies, ligand screening
Insect cellsHigher yields than mammalian, some post-translational capabilitiesIntermediate cost and complexityStructural studies requiring some modifications
Cell-free systemsRapid, avoids toxicity issuesLower yield, higher costDifficult-to-express variants

What are the optimal conditions for reconstitution and storage of recombinant OR8G2?

Proper handling of recombinant OR8G2 is crucial for maintaining protein stability and functionality. Based on established protocols, the following methodological approach is recommended:

Reconstitution Protocol:

  • Centrifuge the lyophilized protein vial briefly before opening to ensure all content settles at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Conditions:

  • Short-term working aliquots: Store at 4°C for up to one week

  • Long-term storage: Store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

The reconstituted protein is typically most stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This buffer composition helps maintain the native conformation of the transmembrane domains that are critical for ligand binding studies.

What methodologies can be employed to study OR8G2 ligand binding interactions?

Several complementary methodologies can be utilized to investigate OR8G2 ligand interactions with varying degrees of resolution and throughput:

  • Molecular Dynamics Simulations:

    • Provide atomic-level understanding of ligand-receptor interactions

    • Can predict binding pocket conformational changes upon ligand binding

    • Requires computational resources and expertise in simulation techniques

    • Particularly valuable given recent advances in structural prediction using AlphaFold2

  • Calcium Imaging Assays:

    • Measures functional responses to potential ligands in cells expressing OR8G2

    • Utilizes calcium-sensitive fluorescent dyes to detect receptor activation

    • Provides real-time measurements of receptor activation kinetics

    • Requires transfection of OR8G2 along with accessory signaling proteins

  • Surface Plasmon Resonance (SPR):

    • Directly measures binding affinities and kinetics

    • Label-free detection of molecular interactions

    • Requires immobilization of either receptor or ligand

    • Can determine association/dissociation rate constants

  • Cryo-Electron Microscopy:

    • Reveals structural details of receptor-ligand complexes

    • Can capture different conformational states

    • Requires specialized equipment and expertise

    • Has been successfully applied to other olfactory receptors like OR51E2

Each methodology has specific strengths and limitations, with the optimal approach depending on the specific research question. Combining multiple techniques often provides the most comprehensive understanding of OR8G2 binding mechanisms.

How can researchers validate the functionality of recombinant OR8G2 after purification?

Validating functional integrity of purified OR8G2 is essential before proceeding with experimental applications. A multi-faceted approach is recommended:

  • Structural Integrity Assessment:

    • SDS-PAGE to confirm expected molecular weight (approximately 34-36 kDa)

    • Circular dichroism (CD) spectroscopy to verify secondary structure composition

    • Western blot using anti-His-tag or OR8G2-specific antibodies

  • Functional Validation:

    • Ligand binding assays using fluorescent or radiolabeled known ligands

    • GTPγS binding assay to measure G-protein coupling efficiency

    • Cell-based reporter assays following reconstitution into liposomes or nanodiscs

  • Thermal Stability Analysis:

    • Differential scanning fluorimetry (DSF) to measure protein stability

    • Monitoring thermal denaturation profiles in the presence/absence of ligands

    • Shifts in melting temperature (Tm) can indicate ligand binding

  • Conformational Homogeneity:

    • Size exclusion chromatography to assess monodispersity

    • Dynamic light scattering to evaluate aggregation state

    • Negative stain electron microscopy for visual confirmation of protein integrity

Protein purity should exceed 90% as determined by SDS-PAGE for most research applications . For structural studies, higher purity (>95%) is typically required to minimize heterogeneity.

How can OR8G2 be incorporated into high-throughput odorant screening platforms?

Developing high-throughput screening (HTS) platforms for OR8G2 requires careful consideration of receptor stability, readout systems, and data analysis approaches:

Methodological Framework for OR8G2 HTS:

  • Expression System Selection:

    • Cell lines stably expressing OR8G2 (HEK293 or HeLa) with appropriate accessory proteins

    • Baculovirus-infected insect cells for higher throughput production

    • Cell-free expression systems coupled with immediate functional assays

  • Assay Formatting Options:

    • Fluorescence-based calcium flux assays in 384 or 1536-well plates

    • BRET/FRET-based conformational change detection

    • Label-free impedance measurements for cell activation

    • Automated patch-clamp for direct electrophysiological measurements

  • Odorant Library Construction:

    • Structurally diverse chemical libraries with known physicochemical properties

    • Concentration gradients to determine dose-response relationships

    • Control for volatility and solubility issues with appropriate vehicle controls

  • Data Analysis and Interpretation:

    • Normalization against positive and negative controls

    • Z-factor calculation to assess assay quality

    • Dose-response curve fitting for potency determination

    • Structure-activity relationship (SAR) analysis

When designing such platforms, researchers should consider the inherent challenges of working with olfactory receptors, including their typically low expression levels and the low solubility of many volatile odorants . Strategies such as receptor engineering and the use of solubility enhancers may improve experimental outcomes.

What are the current methodological approaches for studying OR8G2 in the context of neuronal signaling?

Studying OR8G2 in neuronal contexts requires specialized techniques that bridge molecular mechanisms with cellular function:

  • Primary Olfactory Neuron Cultures:

    • Dissection and culture of rodent olfactory epithelium

    • Transfection or viral transduction to express OR8G2

    • Calcium imaging or electrophysiology to measure neuronal responses

    • Immunocytochemistry to visualize receptor localization

  • Olfactory Organoid Models:

    • Generation of 3D olfactory organoids from stem cells

    • CRISPR-mediated modification to express OR8G2

    • Multi-electrode arrays to record electrical activity

    • Live cell imaging to track receptor trafficking

  • In vivo Approaches:

    • Transgenic animal models expressing modified OR8G2

    • In vivo calcium imaging in awake animals

    • Olfactory behavioral assays

    • Circuit tracing following activation of OR8G2-expressing neurons

  • Computational Integration:

    • Modeling of olfactory bulb circuits activated by OR8G2

    • Signal processing algorithms to analyze complex response patterns

    • Machine learning approaches to correlate receptor activation with perception

These approaches allow researchers to connect molecular events at the receptor level with higher-order neural processing and ultimately behavioral responses to odorants that activate OR8G2.

How do post-translational modifications affect OR8G2 functionality, and how can these be studied?

Post-translational modifications (PTMs) can significantly impact OR8G2 functionality through effects on receptor trafficking, ligand binding affinity, and signaling efficiency:

Key PTMs Relevant to Olfactory Receptors:

Modification TypePotential Effect on OR8G2Methodological Approaches
N-linked GlycosylationAffects trafficking to cell membrane; Influences receptor stabilityMass spectrometry; Site-directed mutagenesis; Glycosidase treatments
PalmitoylationModulates receptor-G protein coupling; Affects lateral mobility in membraneClick chemistry labeling; Metabolic labeling; Acyl-biotin exchange
PhosphorylationRegulates desensitization and internalizationPhospho-specific antibodies; Phosphoproteomics; Kinase inhibitors
UbiquitinationControls receptor degradation; Influences receptor half-lifeUbiquitin pulldowns; Proteasome inhibitors; Mutational analysis

Experimental Strategies:

  • Comparative Analysis: Express OR8G2 in different cell types that perform different patterns of PTMs, then compare receptor function

  • Site-directed Mutagenesis: Create OR8G2 variants where specific modification sites are altered, then assess functional consequences

  • Inhibitor Studies: Use specific inhibitors of enzymes responsible for PTMs to determine effects on receptor function

  • Mass Spectrometry: Employ targeted proteomics to identify and quantify specific modifications on purified OR8G2

When studying PTMs of OR8G2, researchers should consider that E. coli expression systems may not reproduce the modifications present in mammalian cells, potentially affecting experimental outcomes when studying receptor function .

How should researchers address data inconsistencies when comparing OR8G2 studies across different expression systems?

Data inconsistencies across different expression systems represent a significant challenge in OR8G2 research. The following methodological framework can help researchers navigate these challenges:

  • Systematic Comparison Approach:

    • Establish standardized assays that can be applied across expression systems

    • Include internal controls that normalize for system-specific variables

    • Develop correction factors based on calibration curves for each system

  • Detailed Documentation of Expression Conditions:

    • Record complete information about expression vectors, promoters, and tags

    • Document culture conditions, induction methods, and harvest timing

    • Note purification protocols and buffer compositions

  • Protein Characterization Benchmarks:

    • Compare protein yields, purity levels, and specific activity metrics

    • Assess post-translational modification profiles using mass spectrometry

    • Evaluate protein stability and homogeneity across preparations

  • Statistical Approaches to Data Integration:

    • Meta-analysis techniques to combine data from multiple studies

    • Bayesian methods to incorporate prior knowledge and system-specific variables

    • Sensitivity analysis to identify parameters most affecting experimental outcomes

When reconciling data from E. coli-expressed OR8G2 with results from mammalian or insect cell systems, researchers should specifically consider differences in membrane composition, chaperone availability, and post-translational processing capabilities .

What statistical approaches are most appropriate for analyzing OR8G2 ligand screening data?

Ligand screening for OR8G2 generates complex datasets requiring specialized statistical approaches:

When analyzing screening data, researchers should apply the Benjamini & Hochberg false discovery rate correction to adjust p-values when comparing multiple potential ligands, similar to approaches used in differential gene expression analysis .

How can molecular dynamics simulations be effectively integrated with experimental data for OR8G2 research?

Molecular dynamics (MD) simulations provide valuable insights into OR8G2 structure and function, but must be properly integrated with experimental data:

  • Methodological Integration Workflow:

    • Use experimental structural data (or AlphaFold2 predictions) as starting points for MD simulations

    • Validate simulation parameters using experimental observables (e.g., binding affinities)

    • Employ enhanced sampling techniques to explore conformational space more effectively

    • Iterate between computational predictions and experimental validation

  • Multi-scale Modeling Approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) for studying binding site interactions

    • Coarse-grained simulations for membrane embedding and large-scale conformational changes

    • Network models to connect molecular events to cellular responses

    • Systems biology models to place OR8G2 in broader signaling contexts

  • Specific Applications for OR8G2:

    • Ligand binding pocket characterization and binding mode prediction

    • Conformational changes during receptor activation

    • Membrane interactions and receptor oligomerization

    • G-protein coupling mechanisms

  • Practical Implementation:

    • Establish clear hypotheses testable by both computational and experimental methods

    • Design experiments specifically to validate computational predictions

    • Use computational results to guide experimental design

    • Develop quantitative metrics for comparing simulation and experimental results

Recent advances in applying MD simulations to olfactory receptors have shown they can effectively predict the structural alterations induced by odorant binding that lead to receptor activation, such as those observed in the human olfactory receptor OR51E2 .

What are the common challenges in achieving high-yield expression of functional OR8G2, and how can they be addressed?

Researchers commonly encounter several challenges when expressing OR8G2 that can be systematically addressed:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for the expression host

  • Solution: Test different promoter strengths and induction conditions

  • Solution: Evaluate expression at lower temperatures (16-20°C) to improve folding

  • Solution: Co-express molecular chaperones (GroEL/ES, DnaK/J) to assist folding

Challenge 2: Protein Aggregation

  • Solution: Include stabilizing agents such as glycerol or specific lipids in buffers

  • Solution: Use fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Solution: Systematically screen detergents for optimal extraction and stability

  • Solution: Implement directed evolution approaches to identify more stable variants

Challenge 3: Improper Folding

  • Solution: Verify proper disulfide bond formation using non-reducing SDS-PAGE

  • Solution: Include folding enhancers during expression and purification

  • Solution: Attempt refolding from inclusion bodies using controlled dilution methods

  • Solution: Consider mammalian or insect cell expression for complex proteins

Challenge 4: Degradation During Purification

  • Solution: Include protease inhibitors throughout purification process

  • Solution: Minimize handling time and maintain cold temperatures

  • Solution: Optimize buffer conditions (pH, salt concentration, additives)

  • Solution: Consider on-column refolding techniques to minimize aggregation

The key to successful OR8G2 expression lies in systematic optimization, with careful documentation of conditions that influence yield and activity. Starting with established protocols for E. coli expression with appropriate tags can provide a foundation for further optimization .

How should researchers address selectivity and specificity challenges when studying OR8G2 ligand interactions?

Ensuring selectivity and specificity in OR8G2 ligand interaction studies requires rigorous experimental design:

  • Control Implementation:

    • Include structurally related receptors as specificity controls

    • Test ligands against cells lacking OR8G2 expression

    • Use competitive binding assays with known ligands

    • Implement concentration-response studies to establish potency

  • Assay Validation Strategies:

    • Validate assay dynamic range using known modulators of GPCR signaling

    • Determine Z' factor under experimental conditions to confirm assay robustness

    • Test for compound interference with readout systems

    • Include positive and negative controls in each experiment

  • Structure-Activity Relationship Analyses:

    • Systematically modify chemical structures to map binding requirements

    • Identify minimal pharmacophore elements required for activity

    • Distinguish between orthosteric and allosteric binding modes

    • Correlate structural features with functional outcomes

  • Molecular Confirmation Approaches:

    • Site-directed mutagenesis of predicted binding pocket residues

    • Photoaffinity labeling to identify binding sites directly

    • Cross-linking studies to confirm binding orientation

    • Biophysical methods (NMR, SPR) to confirm direct interactions

Similar to approaches used for other olfactory receptors, researchers can leverage molecular dynamics simulations to predict binding sites and interaction mechanisms, which can then guide experimental design for validation studies .

What strategies can be employed to enhance the stability of purified OR8G2 for structural and functional studies?

Maintaining OR8G2 stability is crucial for reliable research outcomes. The following methodological approaches can significantly improve protein stability:

Stabilization Matrix:

Stabilization StrategyImplementation MethodExpected OutcomeConsiderations
Buffer OptimizationSystematic screening of pH, salt concentrations, and additivesIdentified optimal buffer composition for maximum stabilityMay need different buffers for different applications
Lipid/Detergent SelectionTesting diverse detergents and lipid mixtures for stabilizationAppropriate membrane mimetic environmentBalance between stabilization and native-like environment
Thermal StabilizationAddition of ligands, antibodies, or nanobodiesConformational stabilizationMay lock receptor in specific state
Protein EngineeringIntroduction of stabilizing mutations or fusion partnersEnhanced intrinsic stabilityMay affect function or native conformation

Practical Implementation Steps:

  • Initial Assessment:

    • Determine baseline stability using thermal shift assays

    • Monitor time-dependent activity loss under various conditions

    • Identify primary degradation mechanisms (aggregation, proteolysis, oxidation)

  • Stabilization Strategy:

    • For short-term storage (<1 week), maintain at 4°C in optimized buffer

    • For long-term storage, add 50% glycerol and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

    • Consider lyophilization with appropriate cryoprotectants for extended storage

  • Validation:

    • Regularly test functional activity using standardized assays

    • Monitor structural integrity via circular dichroism or fluorescence spectroscopy

    • Verify homogeneity by size exclusion chromatography or dynamic light scattering

The recommended storage conditions for recombinant OR8G2 include maintaining working aliquots at 4°C for up to one week and storing long-term samples at -20°C/-80°C in buffer containing 6% Trehalose at pH 8.0 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.