Recombinant Human Olfactory receptor 8G5 (OR8G5)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptor 8G5

Olfactory Receptor 8G5 (OR8G5) is a protein encoded by the OR8G5 gene in humans. It belongs to the G-protein coupled receptor 1 family and functions as an olfactory receptor, interacting with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell . Olfactory receptors constitute the largest gene family in the human genome, with OR8G5 being one of approximately 380 functional OR genes .

The nomenclature for OR8G5 includes several synonyms: OR8G5P, OR8G6, Olfactory receptor 8G6, and Olfactory receptor OR11-298 . In scientific databases, OR8G5 is identified by the UniProt ID Q8NG78 . As a member of the olfactory receptor family, OR8G5 shares structural and functional characteristics with other olfactory receptors, which are responsible for the recognition and G protein-mediated transduction of odorant signals .

Protein Structure

OR8G5, like other olfactory receptors, features a characteristic 7-transmembrane domain structure common to G-protein-coupled receptors . This structural arrangement is shared with many neurotransmitter and hormone receptors, highlighting the evolutionary conservation of this receptor class . The human OR8G5 protein consists of 311 amino acids in its full-length form .

Genetic and Functional Characteristics

OR8G5 is encoded by a single coding-exon gene, which is typical of olfactory receptor genes . The gene belongs to the largest gene family in the human genome, with the nomenclature for OR8G5 being independent of other organisms . Functionally, OR8G5 participates in the recognition and transduction of odorant signals through G protein-mediated pathways .

Expression Systems and Production

Recombinant Full Length Human Olfactory receptor 8G5 (OR8G5) protein is produced using E. coli expression systems . The recombinant protein includes the complete sequence (amino acids, 1-311) of the human OR8G5 protein, fused to an N-terminal His tag to facilitate purification and detection .

While specific information on OR8G5 production methods is limited, research on other olfactory receptors, such as hOR17-4, provides insights into potential approaches. For instance, hOR17-4 has been expressed in stable tetracycline-inducible mammalian cell lines (HEK293S) using synthetic gene assembly methods that allow for codon optimization and affinity tag attachment .

Reconstitution Protocol

For optimal reconstitution:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add 5-50% glycerol (final concentration) for long-term storage

  4. Aliquot for storage at -20°C/-80°C

The default final concentration of glycerol recommended is 50%, which helps to preserve protein stability during long-term storage .

Antibody Development and Detection Methods

Antibodies against OR8G5 have been developed for research applications, including Western blotting (WB) and immunofluorescence (IF) assays . These antibodies enable the detection and localization of OR8G5 in various tissues and experimental systems, facilitating research on its expression patterns and functions .

Potential Biomarker Applications

Recent research has revealed that olfactory receptors are expressed in various non-olfactory tissues and may serve as biomarkers for certain diseases, including cancer . For instance, OR2B6 has been detected in breast carcinoma tissues but not in healthy tissues, suggesting potential diagnostic applications . While specific information on OR8G5 as a biomarker is limited, its structural similarity to other olfactory receptors suggests it might have similar potential .

Advances in Recombinant Production Technology

Ongoing improvements in recombinant protein production technologies are likely to enhance the yield, purity, and functional properties of recombinant OR8G5 . Research on other olfactory receptors has shown that optimization of expression systems, detergent selection, and purification protocols can significantly improve protein quality and yield .

Biosensor Development

Olfactory receptors have potential applications in the development of biosensors and bionic sensing devices . The high specificity of olfactory receptors for their ligands makes them attractive components for creating novel sensing technologies capable of detecting specific odorants or chemicals .

Therapeutic Targeting Potential

As research on olfactory receptors advances, there is growing interest in their potential as therapeutic targets . Understanding the structure and function of OR8G5 may contribute to the development of novel therapeutic approaches targeting olfactory receptors in various physiological and pathological contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8G5; OR8G5P; OR8G6; Olfactory receptor 8G5; Olfactory receptor 8G6; Olfactory receptor OR11-298
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8G5
Target Protein Sequence
MAAENHSFVTKFILVGLTEKSELQLPLFLVFLGIYVVTVLGNLGMITLIGLSSHLHTPMY CFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY DGYVAICSPLLYSIIISNKACFSLILVVYVIGLICASAHIGCMFRVQFCKFDVINHYFCD LISILKLSCSSTYINELLILIFSGINILVPSLTILSSYIFIIASILRIRYTEGRSKAFST CSSHISAVSVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVHVA LKKTLGKRTFL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19622

KEGG: hsa:219865

UniGene: Hs.722725

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR8G5 and what genomic characteristics should researchers be aware of?

OR8G5 (olfactory receptor family 8 subfamily G member 5) is a protein-coding gene located on chromosome 11q24.2 (specifically at position NC_000011.10: 124256376-124266224). It belongs to the largest gene superfamily in the human genome - the olfactory receptor gene family. OR8G5 is also known by alternative names including OR8G6, OR8G5P, and OR11-298 .

From a structural perspective, OR8G5 contains 2 exons and encodes a G-protein-coupled receptor (GPCR) with the characteristic 7-transmembrane domain structure shared by other olfactory receptors. This structural configuration is critical for its function in odorant recognition and signal transduction .

Researchers should note that olfactory receptors like OR8G5 are frequently affected by copy-number variants (CNVs), potentially creating a mosaic of OR dosages across individuals. This variation should be considered when designing studies involving OR8G5, as it may influence expression levels and functionality in different populations .

How does recombinant OR8G5 interact with odorant molecules?

Like other olfactory receptors, OR8G5 functions through a combinatorial coding mechanism where a single receptor can respond to multiple odorants, and a single odorant can activate multiple receptors. When an odorant molecule binds to OR8G5, it initiates a G-protein-mediated signal transduction cascade that ultimately leads to the perception of a specific smell .

The binding interaction between OR8G5 and odorants is concentration-dependent, with response thresholds typically in the micromolar range, similar to what has been observed with other characterized olfactory receptors. At low concentrations, an odorant might not elicit any cellular response, while at higher concentrations, it may become an agonist for a larger subset of ORs, including OR8G5 .

It's important to note that stereochemistry plays a crucial role in OR-odorant interactions. Some olfactory receptors demonstrate different responses to enantiomers of the same molecule, highlighting the importance of stereochemical characterization in OR8G5 research .

What expression systems are recommended for recombinant OR8G5 studies?

Several heterologous expression systems have been successfully used for olfactory receptor studies, with HEK293 cells being among the most common. For recombinant OR8G5 expression, researchers have found that the tetracycline-inducible HEK293S cell line offers controlled expression levels that can be optimized for functional studies and protein purification .

For optimal expression of OR8G5, modifications such as adding N-terminal and C-terminal tags have proven beneficial. Specifically, a C-terminal rho1D4 epitope tag combined with an N-terminal FLAG epitope tag facilitates both purification and detection of the recombinant receptor .

The following table summarizes common expression systems used for olfactory receptor studies:

Expression SystemAdvantagesLimitationsRecommended Tags
HEK293S (tetracycline-inducible)Controlled expression, good for purificationMay require optimizationN-terminal FLAG, C-terminal rho1D4
Native OSNsPhysiological environmentComplex system, difficult to isolate single receptor effectsNot applicable
Prostate carcinoma cells (LNCaP)May detect ligands missed in other systemsLimited use in literatureVaries

Researchers should consider that assay-dependent bias can significantly impact results, as demonstrated by instances where ORs recognized ligands in one cell line (LNCaP) but not in another (HEK293) .

What methods yield the highest purity for recombinant OR8G5 isolation?

For high-purity isolation of recombinant OR8G5, a two-step purification protocol has been demonstrated to be effective. This approach involves:

  • Monoclonal anti-FLAG immunoaffinity purification

  • Gel filtration chromatography

Using this methodology, researchers have successfully purified both monomeric and dimeric forms of FLAG-rho1D4-tagged human olfactory receptors. From sixty T175 flasks of transfected cells, approximately 1.6 mg of monomeric and 1.1 mg of dimeric receptor forms can be obtained .

The quality of purified OR8G5 should be assessed through size exclusion chromatography-multi-angle light scattering (SEC-MALS) analysis, which can confirm the presence of both monomeric and dimeric forms of the receptor. Additionally, circular dichroism analysis should be performed to verify that the purified receptor maintains proper folding, which is critical for functional studies .

How can researchers detect and analyze copy-number variations affecting OR8G5?

Copy-number variations (CNVs) frequently affect olfactory receptor genomic loci, including OR8G5. To detect these variations, high-resolution oligonucleotide tiling microarrays have proven effective for comprehensive CNV analysis across OR gene and pseudogene loci .

For validation and more targeted analysis of OR8G5 CNVs, quantitative PCR experiments should be conducted. This approach not only confirms microarray results but can also uncover additional CNVs that might be missed by array-based methods .

When analyzing CNVs affecting OR8G5, researchers should consider several key observations from population studies:

  • CNVs are more frequent among OR pseudogenes than among intact genes

  • ORs with a close human paralog or lacking a one-to-one ortholog in chimpanzee show enrichment for CNVs

  • Human-specific deletion alleles have a profound effect on individual OR gene content

These findings suggest that CNVs may play an important evolutionary role in shaping the human olfactory repertoire, and potentially the function of OR8G5 specifically.

What functional assays provide the most reliable data for OR8G5-odorant interaction studies?

Multiple functional assays have been developed to study olfactory receptor-odorant interactions. For OR8G5, real-time cAMP assays in heterologous expression systems offer reliable functional activity data. This approach measures the G-protein-coupled signal transduction cascade activated upon odorant binding .

For direct measurement of OR8G5-odorant binding, intrinsic tryptophan fluorescence assays have demonstrated efficacy. Using this method, researchers have successfully quantified the binding of cognate odorants to detergent-solubilized receptors, revealing affinities in the micromolar range .

The table below compares different functional assays for OR8G5 studies:

Assay TypeMeasuresAdvantagesLimitationsBest For
Real-time cAMPDownstream signalingHigh sensitivity, real-time dataIndirect measure of bindingReceptor activation studies
Intrinsic tryptophan fluorescenceDirect bindingDirect measure of interactionRequires purified proteinBinding affinity determination
Luciferase reporterTranscriptional activationHigh throughput capabilityMultiple steps from bindingScreening multiple compounds
Calcium imagingCa²⁺ fluxVisual cellular responseEquipment intensiveSpatial-temporal dynamics

When interpreting results from these assays, researchers should consider experimental variables such as the concentration of odorants tested, cell line used for OR expression, type of G-protein, co-transfected accessory proteins, and N-terminal modifications that might influence receptor functionality .

How can computational approaches enhance OR8G5 research?

Computational methods have become increasingly valuable for olfactory receptor research. For OR8G5 studies, researchers should utilize resources such as the Molecule to Olfactory Receptor database (M2OR, https://m2or.chemsensim.fr/), which contains curated data on OR-molecule interactions .

This database includes information on:

  • 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs

  • OR responses to molecules and their mixtures

  • Receptor sequences

  • Detailed experimental conditions

Computational approaches can help predict potential ligands for OR8G5 based on structural similarities to known odorants that activate related receptors. This is particularly valuable given that olfactory receptors function through a combinatorial code where each receptor can respond to several different molecules .

When applying computational methods, researchers should consider the stereochemistry of potential ligands, as certain ORs have demonstrated different responses to enantiomers. Additionally, concentration-dependent effects should be incorporated into predictive models, as odorant concentration significantly influences receptor activation probability .

What structural characterization methods are most informative for recombinant OR8G5?

  • Circular dichroism (CD) spectroscopy: This technique can confirm proper folding of purified OR8G5, which is essential for functional studies. CD analysis provides information about the secondary structure content of the receptor .

  • Size exclusion chromatography-multi-angle light scattering (SEC-MALS): This approach allows determination of the oligomeric state of purified OR8G5, distinguishing between monomeric and dimeric forms of the receptor .

  • Intrinsic tryptophan fluorescence: Beyond functional studies, this method can provide insights into conformational changes that occur upon ligand binding .

These methods provide complementary structural information and should be used in combination for comprehensive characterization of recombinant OR8G5. The structural data obtained serves as a foundation for understanding receptor function and can guide future crystallographic and NMR studies aimed at determining the three-dimensional structure of the receptor .

How should controls be designed for OR8G5 functional studies?

Designing appropriate controls is critical for OR8G5 functional studies. Researchers should implement a multi-level control strategy:

  • Empty vector controls: Cells transfected with expression vector lacking the OR8G5 gene to account for endogenous responses.

  • Known agonist controls: Include well-characterized odorants that activate OR8G5 as positive controls.

  • Concentration gradient testing: Test odorants across a range of concentrations (typically 10⁻⁹ to 10⁻³ M) to establish dose-response relationships.

  • Stereoisomer controls: When testing chiral odorants, include stereoisomers to evaluate stereoselectivity of OR8G5 .

Additionally, researchers should consider assay-dependent biases by validating key findings across multiple experimental systems. For example, some ligands have been identified in one cell line but not recognized when the same receptor was expressed in another cell line .

What are the most effective strategies for improving recombinant OR8G5 expression?

Low expression levels and poor membrane trafficking are common challenges when working with recombinant olfactory receptors. For OR8G5, several strategies have proven effective for improving expression:

  • N-terminal modifications: Addition of tags such as FLAG or rhodopsin-derived sequences can enhance membrane trafficking.

  • Inducible expression systems: Tetracycline-inducible systems allow controlled expression that can be optimized to reduce toxicity.

  • Co-expression with accessory proteins: Receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) can significantly improve cell surface expression .

  • Culture condition optimization: Adjusting temperature, induction time, and growth media composition can enhance expression levels.

When implementing these strategies, researchers should carefully verify that modifications do not interfere with the receptor's functional properties by comparing the responses of modified and unmodified receptors to known agonists when possible.

How should researchers interpret conflicting data from different OR8G5 assay systems?

Conflicting results between different assay systems are common in olfactory receptor research and require careful interpretation. When faced with contradictory data for OR8G5, researchers should:

  • Consider assay-specific limitations: Different assays measure different aspects of receptor function (binding vs. signaling), which may not always correlate perfectly.

  • Evaluate experimental conditions: Variables such as expression level, membrane composition, G-protein coupling efficiency, and co-expressed accessory proteins can significantly impact results .

  • Analyze concentration effects: Discrepancies may result from testing different concentration ranges, as odorant responses are strongly concentration-dependent .

  • Examine cell line differences: OR responses can vary between expression systems. For example, some ORs recognize ligands in LNCaP cells but not in HEK293 cells .

To resolve conflicts, researchers should directly compare assay conditions, standardize protocols where possible, and consider employing multiple complementary assays to build a more complete picture of OR8G5 function.

What insights can evolutionary analysis provide for OR8G5 research?

Evolutionary analysis provides valuable context for OR8G5 research. The olfactory receptor gene family has undergone significant changes during human evolution, including gene duplications, pseudogenization, and copy-number variations .

Comparative genomic analyses reveal that CNVs are enriched among ORs with a close human paralog or lacking a one-to-one ortholog in chimpanzee. Interestingly, among the latter group, there is an enrichment in CNV losses over gains, potentially reflecting the known diminution of the human OR repertoire compared to other primates .

Researchers should compare OR8G5 sequences across species to identify conserved regions likely crucial for function and variable regions that might confer species-specific odorant recognition properties. Additionally, examining OR8G5 in the context of common deletion alleles can provide insights into how genetic variation might influence individual differences in olfactory perception .

What emerging technologies could advance OR8G5 structure-function studies?

Several emerging technologies hold promise for advancing OR8G5 research:

  • Cryo-electron microscopy (cryo-EM): Recent advances have made this technique increasingly applicable to membrane proteins, potentially enabling determination of OR8G5's three-dimensional structure at near-atomic resolution.

  • Nanodiscs and lipid cubic phase crystallization: These approaches provide more native-like membrane environments for olfactory receptors, potentially enhancing stability and functional properties for structural studies .

  • AlphaFold and other AI-based structure prediction tools: These computational approaches could provide structural models of OR8G5 to guide experimental design and interpretation.

  • High-throughput functional assays: Advanced screening platforms could enable testing of OR8G5 against larger odorant libraries to better define its recognition spectrum .

  • Single-cell transcriptomics: This approach could provide insights into the expression patterns of OR8G5 in olfactory sensory neurons and potential co-expression with other signaling components.

These technologies, particularly when used in combination, have the potential to overcome current limitations in OR8G5 research and provide deeper insights into the structural basis of odorant recognition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.