Recombinant Human Olfactory receptor 8H1 (OR8H1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

OR8H1 is a class II olfactory receptor localized to chromosome 11q24.2 . Its recombinant form is produced using heterologous expression systems such as E. coli to enable functional studies . Key features include:

PropertyDetails
Protein Length311 amino acids
Molecular Weight~35.2 kDa
Structural Domains7-transmembrane domains typical of GPCRs
Expression SystemE. coli (in vitro)
Storage Conditions-20°C (short-term) or -80°C (long-term); avoid freeze-thaw cycles
ImmunogenSynthesized peptide (amino acids 130–210)

Research Tools and Reagents

Recombinant OR8H1 is utilized in biochemical assays, including:

  • Western blot (WB) and ELISA: Detected at dilutions of 1:500–1:2000 (WB) and 1:5000–1:20,000 (ELISA) .

  • Calcium imaging: Employed in heterologous cell systems (e.g., Hana3A cells) to study receptor activation .

A polyclonal antibody (Catalog #A17586) validated for OR8H1 detection is available, with reactivity confirmed in human samples .

Research Gaps and Challenges

  • Ligand Specificity: OR8H1’s activating odorants are unknown, unlike related receptors (e.g., OR1D2 activated by bourgeonal) .

  • Functional Studies: Limited high-resolution structural or in vivo activation data exist for OR8H1, though computational models suggest metal-ion binding sites critical for ligand interaction .

  • Antisense Transcripts: RNA-Seq data reveal antisense transcripts overlapping OR8H1 in human spermatozoa, suggesting regulatory roles unrelated to odor detection .

Applications in Olfactory Research

Recombinant OR8H1 serves as a model for:

  1. Odorant-Receptor Interaction Studies: Screening odorant libraries to identify agonists/antagonists .

  2. Structural Biology: Homology modeling of GPCR activation mechanisms .

  3. Sperm Chemotaxis: Investigating OR roles in non-olfactory tissues (e.g., spermatozoal calcium signaling) .

Future Directions

  • Deorphanization Campaigns: High-throughput screening using databases like M2OR (75,050 OR-odorant assays) .

  • Therapeutic Targeting: Exploring OR8H1’s role in metabolic or neurological disorders linked to olfactory pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8H1; Olfactory receptor 8H1; Olfactory receptor OR11-180
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8H1
Target Protein Sequence
MGRRNNTNVPDFILTGLSDSEEVQMALFILFLLIYLITMLGNVGMILIIRLDLQLHTPMY FFLTHLSFIDLSYSTVITPKTLANLLTSNYISFMGCFAQMFFFVFLGAAECFLLSSMAYD RYVAICSPLRYPVIMSKRLCCALVTGPYVISFINSFVNVVWMSRLHFCDSNVVRHFFCDT SPILALSCMDTYDIEIMIHILAGSTLMVSLITISASYVSILSTILKINSTSGKQKALSTC ASHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL IRVMQRRQDSR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14824

KEGG: hsa:219469

STRING: 9606.ENSP00000323595

UniGene: Hs.553628

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Olfactory Receptor 8H1 and how is it classified?

Recombinant Human Olfactory Receptor 8H1 (OR8H1) is a member of the large family of olfactory receptors, which comprises approximately 400 receptor types in humans . It belongs to the class A G protein-coupled receptor (GPCR) superfamily . OR8H1, like other olfactory receptors, features the characteristic seven-transmembrane domain structure typical of GPCRs and functions primarily in odorant detection and signal transduction .

The classification of OR8H1 follows the standard nomenclature system for olfactory receptors, where the numeral "8" denotes the family grouping, and "H1" specifies the individual receptor within that family. This classification system helps researchers organize the vast number of olfactory receptors based on sequence similarities and evolutionary relationships.

What expression systems are most effective for producing functional OR8H1 for research?

The expression of functional olfactory receptors, including OR8H1, remains challenging due to their poor heterologous expression. Based on current methodologies, several expression systems can be employed:

HEK293 Cell Expression System:
HEK293 cells are the most commonly used heterologous expression system for olfactory receptors, though they cannot functionally express the majority of ORs without additional factors . For successful expression of OR8H1 in HEK293 cells, co-transfection with accessory proteins is typically required, particularly:

  • RTP1S (Receptor Transporting Protein 1, Short): 0.03 μg of RTP1S pME18S vector per well in 96-well plate format

  • Gαolf: 0.010 μg of Gαolf pME18S vectors per well when using alternative cell lines

Alternative Cell Lines:
Human prostate carcinoma (LNCaP) cell lines have shown success in identifying novel ligands for ORs that were not recognized when expressed in HEK293 cells . This suggests that cell type-specific factors may influence the functional expression of certain ORs, including potentially OR8H1.

Cell-Free Expression Systems:
For protein production without functional assessment, cell-free expression systems can generate recombinant OR proteins with high purity (≥85%), as demonstrated with other olfactory receptors .

What are the current approaches for deorphanization of OR8H1?

Deorphanization (identifying activating ligands) of OR8H1 requires systematic screening approaches. Based on methodologies applied to other olfactory receptors, the following strategies are recommended:

Luciferase-Based Reporter Assay:
This is the most widely used approach for high-throughput screening of OR ligands:

  • Transfection mixture for 384-well format:

    • 0.029 μg of FLAG-Rho-tagged OR8H1 pME18S vector

    • 0.022 μg of CRE/luc2PpGL4.29 (CRE-dependent firefly luciferase)

    • 0.0011 μg of pRL-CMV (constitutively expressed Renilla luciferase)

    • 0.012 μg of RTP1S pME18S vector

  • For cell lines other than HEK293, add 0.010 μg of Gαolf pME18S vector

  • Dose-response analysis should be performed with candidate ligands at concentrations ranging from 10⁻⁹ to 10⁻³ M

Cell Type Selection Strategy:
Different cell types may express OR8H1 with varying functionality. Testing multiple cell lines increases the chances of successful deorphanization:

Cell LineAdvantagesRecommended Transfection Ratio
HEK293Most commonly used, well-characterizedStandard protocol
LNCaPSuccessful with ORs that fail in HEK293Add Gαolf component
Other tissue-derived linesMay contain tissue-specific cofactorsAdjust based on cell-specific requirements

How can computational modeling be applied to predict OR8H1 binding sites?

Computational modeling of OR8H1 binding sites presents challenges due to the limited structural information available for olfactory receptors. Based on recent advances, the following approach is recommended:

Modeling Workflow:

  • AI-Driven Structure Prediction:

    • Utilize AlphaFold Protein Structure Database predictions as a starting point

    • Generate homology models based on the closest related GPCR with solved structure

  • Binding Site Identification:

    • Focus on the transmembrane regions, particularly TM3, TM5, and TM6, which typically contain key residues for ligand interaction in class A GPCRs

    • Identify conserved residues across related ORs

  • Induced-Fit Docking Approach:

    • Sample the binding site conformational space using induced-fit docking simulations

    • Generate an ensemble of receptor conformations for docking studies

  • Model Refinement Protocol:

    • Guide model selection using experimental mutagenesis data, particularly focusing on residues equivalent to positions 3.32 and 6.51 in the Ballesteros-Weinstein numbering system

    • Validate models by their ability to differentiate between active (agonist) and inactive molecules

This approach has been successful in developing models that can rationalize differential activity related to minor structural differences in ligands for other ORs .

What mutagenesis strategies should be employed to study OR8H1 structure-function relationships?

Strategic mutagenesis is crucial for understanding OR8H1's structure-function relationship. The following approach is recommended based on successful studies with other olfactory receptors:

Key Residue Identification:
Based on studies of other ORs, certain positions are critical for ligand binding and receptor activation:

  • Critical Positions for Initial Investigation:

    • Position 3.32 (e.g., L104³·³² in OR5K1): Located in TM3, this position is often involved in direct ligand interactions

    • Position 6.51 (e.g., L255⁶·⁵¹ in OR5K1): Located in TM6, mutations at this position can significantly alter ligand specificity

  • Systematic Mutagenesis Approach:

    • Alanine scanning: Replace each residue in the predicted binding pocket with alanine to identify functional contributions

    • Conservative substitutions: Replace residues with physically/chemically similar amino acids to probe specific interactions

    • Non-conservative substitutions: Change polarity, charge, or size to test binding pocket plasticity

Experimental Validation Protocol:
For each mutant:

  • Verify proper expression and membrane localization using immunofluorescence

  • Assess functional responses using the luciferase reporter system with known ligands

  • Generate dose-response curves to quantify changes in EC₅₀ values

Data Analysis Framework:
Mutational effects can be categorized as:

  • No effect: No change in receptor function

  • Loss of function: Decreased or abolished response to ligands

  • Gain of function: Enhanced response or altered specificity

  • Changed specificity: Different response pattern to a panel of ligands

What techniques are available for analyzing OR8H1 signaling dynamics in real-time?

Real-time analysis of OR8H1 signaling provides insights into receptor activation kinetics and signaling pathways. The following methodologies are recommended:

GPCR Signaling Readout Systems:

  • Calcium Imaging:

    • Co-express OR8H1 with Gα15/16 to redirect signaling to calcium mobilization

    • Use fluorescent calcium indicators (Fluo-4, Fura-2) for real-time monitoring

    • Enables single-cell resolution analysis of receptor activation

  • BRET/FRET-Based Approaches:

    • Bioluminescence/Fluorescence Resonance Energy Transfer

    • Tag OR8H1 and downstream signaling components with appropriate donor/acceptor pairs

    • Allows monitoring of protein-protein interactions in living cells with sub-second temporal resolution

  • Impedance-Based Cellular Analysis:

    • Label-free technique measuring changes in cellular morphology upon receptor activation

    • Provides integrated cellular response profiles

    • Enables continuous monitoring of receptor activation and desensitization

Experimental Design Considerations:

  • Include positive controls (receptors with known ligands) and negative controls (mock-transfected cells)

  • Use RTP1S co-expression to enhance membrane trafficking

  • Perform measurements at physiologically relevant temperatures (33-37°C)

  • Consider pre-incubation with modulators of G protein signaling to characterize pathway specificity

How can poor functional expression of OR8H1 be addressed?

Poor functional expression is a common challenge with olfactory receptors. The following strategies can improve OR8H1 expression and functionality:

Expression Enhancement Strategies:

  • Accessory Protein Co-expression:

    • RTP1S: Enhances OR trafficking to the cell membrane

    • Gαolf: Improves coupling to downstream signaling pathways

    • Ric-8B: Enhances the stability and function of Gαolf

  • N-Terminal Modifications:

    • Rhodopsin tag (first 20 amino acids): Improves membrane targeting

    • Add signal sequences from efficiently expressed membrane proteins

  • Codon Optimization:

    • Adjust codon usage to match the expression system

    • Remove rare codons that may limit translation efficiency

  • Cell Line Selection:

    • Test multiple cell lines as certain ORs show cell-type specific functional expression

    • Consider using olfactory-derived cell lines which may contain endogenous factors supporting OR expression

Optimization Protocol:
Systematic testing of expression conditions is recommended using a factorial design approach:

FactorOptions to Test
Temperature30°C, 33°C, 37°C
Expression duration24h, 48h, 72h
Accessory protein ratioVarious ratios of RTP1S:Gαolf:OR8H1
Media supplementsSodium butyrate, DMSO at low concentrations

What controls are essential for validating OR8H1 functional assays?

Proper controls are critical for reliable interpretation of OR8H1 functional data. The following control systems should be included:

Essential Controls for OR8H1 Functional Assays:

  • Positive Expression Controls:

    • Well-characterized ORs with known ligands (e.g., OR5K1 with its validated agonists)

    • Non-olfactory GPCRs with robust expression and function (e.g., β2-adrenergic receptor)

  • Negative Controls:

    • Empty vector transfection

    • OR8H1 with inactivating mutation in key residue

    • OR8H1 without accessory proteins

  • Assay System Controls:

    • Forskolin treatment to directly activate adenylyl cyclase (pathway validation)

    • Ionomycin for calcium imaging assays (cell viability)

    • Constitutively active G protein mutants (positive control for downstream signaling)

  • Ligand Controls:

    • Vehicle control (solvent used for ligand preparation)

    • Structurally related compounds to test specificity

    • Known antagonists of related receptors

Control Data Interpretation:

  • Positive controls should show >5-fold signal over background

  • Negative controls should not exceed 2-fold over background

  • Dose-response curves should be generated for all active compounds

  • EC₅₀ values should be calculated with appropriate statistical analysis

How might single-cell analysis technologies advance our understanding of OR8H1 function?

Single-cell analysis represents a frontier in understanding the heterogeneity of OR8H1 expression and function across different cell populations. The following approaches show promise:

Single-Cell RNA-Seq Applications:

  • Characterize the transcriptome of individual OR8H1-expressing cells

  • Identify co-expressed factors that might influence OR8H1 function

  • Map cell-type specific expression patterns in both olfactory and non-olfactory tissues

Single-Cell Proteomics:

  • Analyze the proteome of OR8H1-expressing cells

  • Identify protein interaction networks associated with OR8H1

  • Characterize post-translational modifications affecting receptor function

Microfluidic-Based Functional Assays:

  • Isolate and analyze individual OR8H1-expressing cells

  • Perform high-throughput ligand screening on single cells

  • Correlate functional responses with gene expression profiles

What is the potential role of OR8H1 in non-olfactory tissues?

Olfactory receptors have been identified in various non-olfactory tissues where they play unexpected physiological roles. Investigation of OR8H1 in these contexts may reveal novel functions:

Methodological Approach for Identifying Non-Olfactory Functions:

  • Expression Analysis:

    • RT-PCR and quantitative PCR to detect OR8H1 transcripts in various tissues

    • Immunohistochemistry with validated antibodies to locate protein expression

    • Single-cell RNA-seq to identify specific cell types expressing OR8H1

  • Functional Characterization:

    • Gene knockout or knockdown studies in relevant cell types

    • Overexpression of OR8H1 followed by transcriptome and proteome analysis

    • Metabolomic profiling to identify endogenous ligands

  • Physiological Assessment:

    • Tissue-specific conditional knockout models

    • Ex vivo tissue function assays

    • In vivo physiological measurements in wild-type vs. OR8H1-deficient models

Potential Non-Olfactory Roles:
Based on findings with other ORs, OR8H1 might function in:

  • Chemosensation in non-olfactory tissues

  • Regulation of cellular metabolism

  • Cell migration or proliferation

  • Tissue-specific endocrine functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.