Recombinant Human Olfactory receptor 8I2 (OR8I2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Profile

Recombinant Human Olfactory Receptor 8I2 (OR8I2) is a genetically engineered form of the olfactory receptor OR8I2, a class A G protein-coupled receptor (GPCR) involved in odorant detection . Produced via in vitro expression systems, this transmembrane protein retains structural and functional properties critical for studying olfactory signaling mechanisms .

Domain Organization

RegionResiduesFunction
TM1–TM731–310Ligand binding, structural stability
ExtracellularECL1–ECL3Odorant recognition
IntracellularICL1–ICL3G-protein interaction

Biophysical analyses (e.g., circular dichroism) confirm proper folding of recombinant OR8I2, essential for functional assays .

Research Applications

Recombinant OR8I2 facilitates diverse experimental workflows:

Ligand Screening

While OR8I2 remains an orphan receptor (no confirmed odorant ligand) , its recombinant form is used in:

  • Calcium imaging assays to identify activating odorants .

  • Intrinsic tryptophan fluorescence assays for ligand-binding studies .

Antibody Development

Polyclonal antibodies targeting OR8I2 (e.g., Boster Bio A16910) validate receptor expression in heterologous systems (e.g., HEK293, HeLa cells) .

  • Western blot dilution: 1:500–1:2000 .

  • Immunogen: Peptide spanning residues 30–110 .

Expression and Purification Data

ParameterDetails
SourceE. coli expression system
Purity>90% (SDS-PAGE)
Yield~2.7 mg per 60 T175 flasks
Functional ValidationcAMP assays in HEK293 cells

Challenges and Future Directions

  • Ligand Deorphanization: High-throughput screens using odorant libraries (e.g., M2OR database) may identify OR8I2 agonists .

  • Antisense Transcripts: OR8I2 antisense RNA detected in spermatozoa suggests non-canonical roles in reproduction .

  • Dimerization: Monomer-dimer equilibrium impacts signal transduction but remains poorly characterized .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which serves as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it according to your specification.
Synonyms
OR8I2; Olfactory receptor 8I2; Olfactory receptor OR11-170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8I2
Target Protein Sequence
MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMY FFLSNLAFIDIFYSSTVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAY NRYIAICNPLLYSVVMSQKVSNWLGVMPYVIGFTSSLISVWVISSLAFCDSSINHFFCDT TALLALSCVDTFGTEMVSFVLAGFTLLSSLLIITVTYIIIISAILRIQSAAGRQKAFSTC ASHLMAVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL LRVIHRKLFP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15310

KEGG: hsa:120586

STRING: 9606.ENSP00000303864

UniGene: Hs.554524

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of recombinant human OR8I2 and how does it compare to native OR8I2?

Recombinant human OR8I2 is a full-length (310 amino acids) transmembrane protein that maintains the characteristic 7-transmembrane domain structure typical of G protein-coupled receptors. The protein sequence (MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMYFFLSNLAFIDIFYSSTVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAYNRYIAICNPLLYSVVMSQKVSNWLGVMPYVIGFTSSLISVWVISSLAFCDSINHFFCDTTALLALSCVDTFGTEMVSFVLAGFTLLSSLLIITVTYIIIISAILRIQSAAGRQKAFSTCASHLMAVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNALLRVIHRKLFP) is identical to the native protein, though recombinant variants often include additional features such as affinity tags .

When produced in expression systems like E. coli, recombinant OR8I2 typically includes an N-terminal 10xHis-tag to facilitate purification and detection . While the core protein structure remains conserved, these modifications may introduce subtle differences in protein folding or interaction kinetics compared to the native form. Researchers should consider these potential variations when designing experiments, particularly when studying protein-protein or protein-ligand interactions.

What expression systems are most effective for producing functional recombinant OR8I2?

The most widely documented expression system for recombinant OR8I2 production is the in vitro E. coli expression system . This bacterial system offers advantages including:

  • High protein yield

  • Established protocols for induction and harvest

  • Cost-effectiveness for large-scale production

  • Compatibility with affinity purification approaches

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
Insect cellsBetter membrane protein foldingHigher cost, longer production timeFunctional studies, interaction assays
Mammalian cellsNative-like modificationsHighest cost, complex protocolsSignaling studies, pharmacological testing

The selection of an appropriate expression system should be guided by the specific research questions being addressed and the downstream applications planned for the recombinant protein.

What are the optimal storage conditions for maintaining recombinant OR8I2 stability?

Maintaining the stability and activity of recombinant OR8I2 requires careful attention to storage conditions. According to product specifications, recombinant OR8I2 should be stored at -20°C for regular usage, with -80°C recommended for extended storage periods . Working aliquots can be maintained at 4°C for up to one week, though repeated freeze-thaw cycles should be strictly avoided as they can lead to protein degradation and loss of activity .

The shelf life of recombinant OR8I2 depends on several factors:

  • For liquid formulations: approximately 6 months at -20°C/-80°C

  • For lyophilized formulations: approximately 12 months at -20°C/-80°C

Buffer composition significantly impacts protein stability. Most commercial preparations of recombinant OR8I2 are supplied in specialized buffers containing stabilizing agents. For instance, some preparations use Tris-based buffers with 50% glycerol, optimized specifically for this protein . When preparing your own storage buffers, consider including:

  • Cryoprotectants (glycerol at 20-50%)

  • Reducing agents (DTT or β-mercaptoethanol)

  • Protease inhibitors

  • Appropriate pH (typically 7.4-8.0 for OR8I2)

How can researchers effectively design ligand binding studies for recombinant OR8I2?

Designing effective ligand binding studies for OR8I2 requires consideration of the receptor's natural binding properties and signaling mechanisms. Olfactory receptors display affinity for a range of odor molecules rather than binding to specific ligands exclusively, and a single odorant molecule may bind to multiple olfactory receptors with varying affinities based on molecular volume and other physio-chemical properties .

A comprehensive ligand binding experimental design should include:

  • Preparation of functional receptor:

    • Ensure recombinant OR8I2 is properly folded in a membrane environment

    • Consider reconstitution in lipid vesicles or nanodiscs for more native-like conditions

    • Validate receptor functionality before binding assays

  • Selection of candidate ligands:

    • Choose structurally diverse odorants

    • Include both known GPCR ligands and novel candidates

    • Consider molecular volume and lipophilicity

  • Binding assay selection:

    • Fluorescence-based assays (FRET, fluorescence polarization)

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Radioligand binding assays

  • Controls and validation:

    • Include positive controls (known OR ligands)

    • Negative controls (non-binding compounds)

    • Competition assays to determine binding specificity

  • Downstream functional validation:

    • Calcium flux assays to measure receptor activation

    • cAMP assays to confirm G-protein coupling

    • Receptor internalization studies

When analyzing results, researchers should evaluate both binding affinity (Kd) and efficacy (ability to activate signaling pathways) to comprehensively characterize ligand-receptor interactions.

What methodologies are most effective for studying the signal transduction mechanisms of recombinant OR8I2?

Studying the signal transduction mechanisms of OR8I2 requires techniques that can capture the sequential molecular events following receptor activation. Olfactory receptors like OR8I2 primarily signal through G protein (Golf and/or Gs) activation, which subsequently activates adenylate cyclase to convert ATP into cyclic AMP (cAMP), ultimately leading to the opening of cyclic nucleotide-gated ion channels .

Effective methodological approaches include:

  • G-protein coupling assays:

    • [35S]GTPγS binding assays to measure G-protein activation

    • BRET/FRET-based assays to monitor receptor-G protein interactions

    • Co-immunoprecipitation studies to identify specific G-protein subtypes recruited

  • Second messenger detection:

    • Real-time cAMP biosensors (EPAC-based FRET sensors)

    • Radio-immunoassays for cAMP quantification

    • Phosphodiesterase inhibitors (IBMX) can be used to prevent cAMP degradation

  • Downstream signaling detection:

    • Calcium imaging with fluorescent indicators (Fura-2, Fluo-4)

    • Patch-clamp electrophysiology for ion channel activation

    • Protein kinase A (PKA) activity assays

  • Molecular biology approaches:

    • Site-directed mutagenesis to identify critical residues for signal transduction

    • Chimeric receptors to map domains involved in G-protein coupling

    • CRISPR-based gene editing to study receptor function in cellular contexts

A typical experimental workflow might involve:

StepMethodMeasurable OutcomeAnalysis Approach
Receptor activationLigand binding assayBinding affinity (Kd)Scatchard or Hill plot
G-protein coupling[35S]GTPγS bindingIncreased GTPγS bindingFold-change over basal
cAMP productionFRET-based cAMP sensorChange in FRET ratioKinetic analysis
Ion channel activationPatch-clamp electrophysiologyCurrent amplitudeI-V relationship
Cellular responseCalcium imagingFluorescence intensityArea under curve

These methodologies should be selected based on the specific aspects of OR8I2 signaling that are being investigated.

What are the challenges and solutions for structural characterization of recombinant OR8I2?

Structural characterization of GPCRs like OR8I2 presents significant challenges due to their transmembrane nature, conformational flexibility, and expression difficulties. Here are the key challenges and methodological solutions:

Challenges:

  • Low expression levels in heterologous systems

  • Protein instability outside of membrane environments

  • Conformational heterogeneity

  • Difficulty in obtaining crystals for X-ray diffraction

  • Complex post-translational modifications

Methodological Solutions:

  • Enhanced expression strategies:

    • Use fusion partners (T4 lysozyme, BRIL) to increase stability

    • Codon optimization for expression system

    • Thermostabilizing mutations

    • Regulated induction protocols

  • Membrane mimetics for stabilization:

    • Detergent micelles (DDM, LMNG)

    • Lipid nanodiscs

    • Styrene-maleic acid copolymer lipid particles (SMALPs)

    • Bicelles or amphipols

  • Advanced structural techniques:

    • Cryo-electron microscopy (preferred for large membrane protein complexes)

    • NMR spectroscopy for dynamic regions

    • X-ray crystallography with LCP (Lipidic Cubic Phase)

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Computational approaches:

    • Homology modeling based on related ORs

    • Molecular dynamics simulations

    • Machine learning predictions

    • Fragment-based computational docking

A comprehensive structural characterization workflow might involve:

  • Initial homology modeling to generate testable hypotheses

  • Expression optimization using fusion constructs

  • Purification in suitable detergents or nanodiscs

  • Validation of protein folding via circular dichroism

  • Primary structure determination via cryo-EM or X-ray crystallography

  • Refinement with computational methods

  • Functional validation of structural insights

The integration of multiple complementary techniques is essential for overcoming the inherent challenges in OR8I2 structural characterization.

What controls are essential when validating the functionality of recombinant OR8I2?

Validating the functionality of recombinant OR8I2 requires a systematic approach with appropriate controls at multiple levels. Essential controls include:

  • Expression and purification controls:

    • Non-transfected/non-induced cells as negative controls

    • Western blotting with anti-His antibodies to confirm expression and molecular weight

    • Size exclusion chromatography to assess protein homogeneity

    • Mass spectrometry validation of protein sequence

  • Structural integrity controls:

    • Circular dichroism spectroscopy to confirm alpha-helical content expected of 7TM receptors

    • Fluorescence spectroscopy to assess proper folding

    • Limited proteolysis to evaluate resistance to digestion (properly folded transmembrane regions are often protected)

  • Functional controls:

    • Known OR ligands as positive controls

    • Structurally similar non-olfactory GPCRs as comparative controls

    • Mutated OR8I2 versions (e.g., key binding site mutations) as negative controls

    • Downstream signaling assays with Golf coupling inhibitors

  • System-specific controls:

    • Assay methodology controls (temperature, buffer conditions)

    • Vehicle controls for solvents used in ligand preparation

    • Time-dependent stability measurements

When designing a validation workflow, researchers should incorporate a "functional fingerprint" approach by measuring multiple parameters across different experimental conditions. A validation matrix might include:

Validation LevelPositive ControlNegative ControlTechnical Considerations
ExpressionAnti-His Western blotEmpty vectorSample loading normalization
FoldingCD spectrum analysisHeat-denatured proteinBuffer subtraction
Ligand bindingKnown OR ligandsNon-binding analogsNon-specific binding correction
G-protein couplingGTPγS bindingCoupling-deficient mutantGDP background subtraction
SignalingcAMP inductionAdenylyl cyclase inhibitorCell viability normalization

This multi-parameter approach provides robust evidence for functional recombinant OR8I2 production.

How can researchers optimize recombinant OR8I2 purification for downstream functional studies?

Optimizing purification protocols for functional OR8I2 requires balancing high yield with protein quality and activity. The following methodological approach is recommended:

  • Initial extraction optimization:

    • Test multiple detergents (DDM, LMNG, CHAPS) at varying concentrations

    • Optimize solubilization time and temperature

    • Consider adding stabilizing agents during extraction (cholesterol, specific lipids)

    • Use protease inhibitor cocktails to prevent degradation

  • Affinity purification:

    • Leverage the N-terminal 10xHis-tag for IMAC (Immobilized Metal Affinity Chromatography)

    • Optimize imidazole concentration in binding and elution buffers

    • Consider shorter purification times at 4°C to maintain activity

    • Evaluate on-column detergent exchange options

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for charge variant separation

    • Affinity chromatography with immobilized ligands for functional selection

  • Quality assessment:

    • SDS-PAGE for purity assessment

    • Western blotting for identity confirmation

    • Dynamic light scattering for homogeneity analysis

    • Binding assays for functionality verification

A systematic optimization workflow should include:

Purification StepKey VariablesOptimization MetricsAnalytical Methods
Cell lysisBuffer composition, mechanical methodCell disruption efficiencyMicroscopy, protein yield
Membrane isolationCentrifugation speed/timeMembrane fraction purityWestern blot (membrane markers)
Detergent solubilizationDetergent type, concentrationSolubilization efficiencyProtein quantification
IMAC purificationImidazole gradient, flow ratePurity, yieldSDS-PAGE, protein assay
Size exclusionBuffer composition, flow rateMonodispersityUV absorbance profile, DLS
Functional validationLigand panelBinding activityLigand binding assays

For recombinant OR8I2 specifically, researchers should consider:

  • Using gentle elution conditions to maintain the native conformation

  • Adding glycerol (typically 10-20%) to stabilize the purified protein

  • Avoiding buffer conditions that might disrupt the transmembrane structure

  • Immediately assessing activity post-purification, as activity may decrease over time

What experimental approaches can differentiate between specific and non-specific binding in OR8I2 ligand screening?

Differentiating between specific and non-specific binding is crucial when characterizing ligand interactions with olfactory receptors like OR8I2, as these receptors naturally display affinity for multiple odorants with varying specificities . The following methodological approaches can help researchers make this critical distinction:

  • Saturation binding analysis:

    • Perform concentration-dependent binding studies

    • Plot binding curves and assess for saturation plateau

    • Calculate Bmax (maximum binding capacity) and Kd (dissociation constant)

    • True specific binding will show saturation, while non-specific binding is typically linear

  • Competition assays:

    • Conduct displacement studies with unlabeled compounds

    • Generate IC50 values for multiple ligands

    • Calculate Ki values using the Cheng-Prusoff equation

    • Rank compounds by binding affinity

  • Binding kinetics analysis:

    • Measure association (kon) and dissociation (koff) rates

    • Calculate residence times (1/koff)

    • Specific binding typically shows predictable kinetic profiles

    • Compare with known ligands of related receptors

  • Mutagenesis approaches:

    • Identify putative binding pocket residues through homology modeling

    • Generate site-directed mutants of key residues

    • Test effects of mutations on binding affinity

    • Specific binding will be affected by targeted mutations

  • Functional correlation:

    • Compare binding affinity with functional activation

    • Test correlation between binding parameters and downstream signaling

    • True ligands should demonstrate both binding and functional responses

A comprehensive experimental design might include:

ApproachMethodExpected Result for Specific BindingData Analysis
Saturation bindingIncreasing ligand concentrationsHyperbolic curve reaching plateauNon-linear regression (one-site binding)
Competition bindingDisplacement with unlabeled ligandsDose-dependent displacement, structure-activity relationshipsIC50 and Ki calculation
Binding kineticsReal-time binding measurementsConcentration-dependent kon, consistent koffAssociation/dissociation curve fitting
Orthogonal binding sitesMultiple labeled ligandsDifferential competition patternsAllosteric versus orthosteric binding models
Functional correlationBinding + downstream signalingCorrelation between binding affinity and efficacyScatter plots, correlation coefficients

These approaches provide complementary evidence to distinguish genuine OR8I2 ligands from compounds showing non-specific interactions with the receptor or experimental system.

What are common challenges in recombinant OR8I2 expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant OR8I2. Here are the most common issues and evidence-based solutions:

  • Low expression yields:

    • Problem: OR8I2, like many GPCRs, often expresses at low levels in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Use stronger inducible promoters

      • Lower induction temperature (16-18°C)

      • Add chemical chaperones (glycerol, DMSO at low concentrations)

      • Consider fusion partners that enhance expression (MBP, SUMO)

  • Protein misfolding and aggregation:

    • Problem: Transmembrane proteins can misfold and aggregate when overexpressed.

    • Solutions:

      • Reduce expression rate with lower inducer concentrations

      • Add membrane-mimetic environments during extraction

      • Include stabilizing agents in lysis buffers

      • Screen multiple detergents for optimal solubilization

      • Consider mild solubilization techniques (high salt, pH adjustments)

  • Proteolytic degradation:

    • Problem: Partial degradation during expression or purification.

    • Solutions:

      • Use protease-deficient expression strains

      • Add protease inhibitor cocktails during all purification steps

      • Optimize purification speed to minimize exposure time

      • Consider lower temperatures throughout the process

      • Analyze degradation patterns to identify susceptible regions

  • Toxicity to expression host:

    • Problem: Membrane protein overexpression can be toxic to host cells.

    • Solutions:

      • Use tightly regulated expression systems

      • Optimize cell density at induction

      • Employ specialized strains designed for toxic protein expression

      • Consider cell-free expression systems for highly toxic proteins

A systematic troubleshooting approach might include:

ChallengeDiagnostic TestOptimization StrategySuccess Indicator
Low yieldSDS-PAGE/Western blot of lysatePromoter strength adjustmentIncreased band intensity
AggregationSize exclusion chromatographyDetergent screenMonodisperse peak
DegradationN- and C-terminal tag detectionProtease inhibitor optimizationSingle band on Western blot
Host toxicityGrowth curve analysisInduction timing adjustmentNormal growth post-induction
FunctionalityLigand binding assayExpression condition optimizationMeasurable specific binding

When working specifically with OR8I2, researchers should be aware that:

  • The optimal expression temperature may be lower than standard protocols suggest

  • The inclusion of glycerol in buffers significantly enhances stability

  • Extended storage may affect functionality, necessitating fresh preparations for critical experiments

How should researchers interpret variable or contradictory results in OR8I2 signaling studies?

Variability in OR8I2 signaling data is common due to the complex nature of GPCR signaling and the technical challenges in working with olfactory receptors. When facing contradictory results, researchers should consider these methodological approaches:

  • Systematic source analysis:

    • Protein-related variables: Batch-to-batch variability, storage conditions, tag interference

    • System-related variables: Cell type differences, endogenous signaling components

    • Assay-related variables: Detection method sensitivity, temporal resolution

    • Ligand-related variables: Purity, stability, solubility in assay buffers

  • Orthogonal methodology validation:

    • Confirm key findings using multiple, independent techniques

    • Compare direct (binding) vs. indirect (signaling) measurements

    • Assess concentration-response relationships across methods

    • Consider temporal aspects of signaling cascades

  • Biological context consideration:

    • Native vs. heterologous expression systems

    • Presence of accessory proteins that may modify signaling

    • Receptor expression levels and surface localization

    • Cellular compartmentalization of signaling components

  • Statistical and analytical approaches:

    • Perform replicate experiments with appropriate sample sizes

    • Use statistical methods appropriate for the data distribution

    • Consider Bayesian approaches for complex datasets

    • Develop quantitative models that incorporate multiple parameters

When analyzing contradictory data, create a systematic evaluation table:

ParameterTechnique 1Technique 2Possible Explanation for Discrepancy
EC50/IC50Value ± SDValue ± SDAssay sensitivity differences
Efficacy% of reference% of referenceReceptor reserve, signal amplification
Time courset1/2t1/2Measurement kinetics, temporal resolution
System dependenceCell type A resultCell type B resultDifferential expression of signaling components

To specifically address OR8I2 signaling variability:

  • Consider that olfactory receptors naturally respond to multiple ligands with varying affinities

  • Assess the impact of receptor densities on signaling outcomes

  • Evaluate potential allosteric modulators in the experimental system

  • Compare results with structurally related olfactory receptors as internal controls

What approaches can distinguish between specific OR8I2 functions and general characteristics of olfactory receptors?

Distinguishing OR8I2-specific functions from general olfactory receptor characteristics requires targeted experimental designs that isolate the unique properties of this receptor. Here are methodological approaches to achieve this differentiation:

  • Comparative receptor profiling:

    • Express multiple olfactory receptors (including OR8I2) under identical conditions

    • Screen against the same ligand library

    • Analyze response patterns for receptor-specific signatures

    • Generate response fingerprints for classification

  • Chimeric receptor studies:

    • Create chimeras between OR8I2 and other olfactory receptors

    • Systematically swap domains (N-terminus, transmembrane regions, loops)

    • Map functional differences to specific structural elements

    • Identify regions conferring unique response characteristics

  • Site-directed mutagenesis:

    • Target conserved versus non-conserved residues

    • Focus on predicted binding pocket residues

    • Create gradual transitions between OR8I2 and related receptors

    • Correlate sequence differences with functional outcomes

  • Transcriptomic and expression pattern analysis:

    • Compare tissue and cellular expression patterns of OR8I2 versus other ORs

    • Identify co-expressed genes that might represent functional partners

    • Analyze developmental regulation patterns

    • Map expression to specific olfactory zones

  • Physiological response correlation:

    • Connect in vitro findings to in vivo olfactory responses

    • Use transgenic models with modified OR8I2 expression

    • Perform psychophysical studies with OR8I2 ligands

    • Correlate molecular mechanisms with perceptual outcomes

A methodical approach to distinguishing OR8I2-specific functions might include:

ApproachControl ComparisonExpected OR8I2-Specific FindingAnalytical Method
Ligand screeningPanel of olfactory receptorsUnique response profileHierarchical clustering
Structure-functionConserved vs. variable regionsCritical non-conserved residuesMutation impact analysis
Signaling pathwayG-protein coupling specificityPreferential coupling patternBioluminescence resonance energy transfer
Expression patternRelated OR subfamily membersDistinct spatial/temporal expressionIn situ hybridization, single-cell RNA-seq
Physiological roleKnockout/knockin modelsSpecific olfactory deficitBehavioral testing, electrophysiology

For OR8I2 specifically, researchers should consider:

  • Its classification within olfactory receptor family 8, subfamily I

  • Its unique amino acid sequence compared to other subfamily members

  • Potential specialized functions that may exist beyond standard olfactory detection

  • The possibility of extranasal expression and function, as observed with other olfactory receptors

By systematically applying these approaches, researchers can build a comprehensive understanding of OR8I2's unique properties distinct from the general characteristics of the olfactory receptor family.

What emerging technologies hold promise for advancing OR8I2 research?

The study of olfactory receptors like OR8I2 is poised to benefit from several cutting-edge technologies that can address current limitations and open new research avenues. These emerging approaches include:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy with improved resolution for membrane proteins

    • Micro-electron diffraction (MicroED) for small crystals

    • Serial femtosecond crystallography at X-ray free-electron lasers

    • Integrative structural biology combining multiple data sources

  • Novel expression and reconstitution systems:

    • Cell-free expression systems optimized for membrane proteins

    • Nanodiscs with tunable lipid compositions

    • Polymeric membrane scaffolds

    • 3D bioprinting of organized receptor arrays

  • High-throughput functional screening platforms:

    • Microfluidic devices for single-cell analysis

    • Droplet-based digital assays

    • Label-free detection systems

    • Machine learning-assisted data analysis and pattern recognition

  • Advanced imaging technologies:

    • Super-resolution microscopy of receptor clustering and trafficking

    • Single-molecule tracking of receptor dynamics

    • FRET/BRET sensors for real-time conformational changes

    • Correlative light and electron microscopy

  • Genetic and genomic approaches:

    • CRISPR-based functional genomics

    • Single-cell transcriptomics of olfactory neurons

    • Precise genome editing in model organisms

    • Optogenetic control of receptor activation

These technologies could address specific challenges in OR8I2 research:

Research ChallengeEmerging TechnologyPotential ImpactDevelopment Timeline
Structural determinationCryo-EM with improved resolutionAtomic-level binding site characterization1-3 years
Functional mappingCRISPR-based screeningIdentification of critical domains and residuesCurrent
Ligand discoveryAI-driven virtual screeningExpanded ligand repertoire identification1-2 years
Signaling dynamicsReal-time biosensorsTemporal signaling profilesCurrent
In vivo functionChemogenetic approachesBehavioral correlates of OR8I2 activation2-4 years

Researchers should consider how these emerging technologies might be integrated into comprehensive research programs to overcome current limitations in understanding OR8I2 structure, function, and physiological roles.

How might OR8I2 research inform our broader understanding of sensory perception mechanisms?

OR8I2 research extends beyond the specific receptor to inform fundamental principles of sensory perception. Strategic research approaches in this area can yield insights with broad implications:

  • Receptor coding principles:

    • Investigate how OR8I2 contributes to combinatorial odor coding

    • Analyze response patterns across concentration ranges

    • Map OR8I2 activation to perceptual qualities

    • Model information processing from receptor activation to perception

  • Signaling integration mechanisms:

    • Study convergence of OR8I2 signals with other olfactory inputs

    • Analyze temporal aspects of signal processing

    • Investigate adaptation and sensitization mechanisms

    • Examine cross-modal sensory integration

  • Evolutionary perspectives:

    • Compare OR8I2 structure and function across species

    • Analyze selective pressures on receptor properties

    • Identify conserved versus divergent mechanisms

    • Relate receptor specialization to ecological niches

  • Translational applications:

    • Develop OR8I2-based biosensors for environmental monitoring

    • Explore therapeutic applications for olfactory disorders

    • Investigate implications for flavor perception and food science

    • Apply insights to artificial sensory system design

A research framework linking OR8I2 to broader sensory perception might include:

Research LevelOR8I2-Specific ApproachBroader ImplicationMethodological Approach
MolecularStructure-function relationshipsPrinciples of chemosensationMutagenesis, modeling
CellularSignaling pathway mappingSignal transduction mechanismsLive-cell imaging, electrophysiology
CircuitConnectivity patternsInformation processing principlesCircuit tracing, functional imaging
PerceptualPsychophysical correlatesSensation to perception transformationHuman sensory testing
SystemsIntegration with other sensesMultimodal sensory processingBehavioral testing, neuroimaging

By strategically positioning OR8I2 research within this broader framework, investigators can extract principles that extend to other sensory modalities and contribute to our fundamental understanding of how the brain processes sensory information.

How can researchers ensure reproducibility in OR8I2 studies across different laboratories?

Ensuring reproducibility in OR8I2 research requires systematic methodological standardization and comprehensive reporting. Researchers should adopt these evidence-based practices:

  • Standardized materials and reagents:

    • Use well-characterized recombinant protein preparations with detailed production methods

    • Report complete protein sequences including any tags or modifications

    • Document source, catalog numbers, and lot numbers for commercial reagents

    • Consider establishing reference standards for key experiments

  • Detailed methodological reporting:

    • Provide complete protocols with sufficient detail for replication

    • Specify critical parameters (temperatures, incubation times, buffer compositions)

    • Report equipment models and settings

    • Share analytical methods, including software versions and parameters

  • Comprehensive data sharing:

    • Deposit raw data in appropriate repositories

    • Share analysis code and computational workflows

    • Provide complete datasets, not just representative examples

    • Consider pre-registration of study designs for critical experiments

  • Validation across systems:

    • Test key findings in multiple expression systems

    • Validate with different methodological approaches

    • Consider inter-laboratory validation for critical findings

    • Report both positive and negative results

A reproducibility-focused approach to OR8I2 research might include:

Reproducibility ComponentPractical ImplementationDocumentation MethodVerification Approach
Protein characterizationMultiple quality checksCertificate of analysisIndependent verification
Experimental protocolsStep-by-step proceduresProtocol repositoriesProtocol exchange
Data analysisDocumented pipelinesShared code repositoriesIndependent reanalysis
Reagent validationFunctionality testingValidation datasetsCross-laboratory testing
Statistical approachesPre-defined analysis plansStatistical reporting checklistsSensitivity analyses

For OR8I2 specifically, researchers should pay particular attention to:

  • Detailing expression and purification methods that may affect protein functionality

  • Specifying storage conditions that maintain receptor stability

  • Documenting the precise composition of assay systems, particularly lipids or detergents present

  • Reporting comprehensive characterization of ligand binding properties, including negative results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.