Recombinant Human Olfactory receptor 8K1 (OR8K1)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purification

Recombinant OR8K1 is typically expressed in heterologous systems due to challenges in native olfactory neuron isolation. Common methods include:

  • HEK293 Cells: Engineered lines (e.g., Hana3A) co-expressing chaperones (RTP1/2) to enhance receptor trafficking to the cell membrane .

  • Epitope Tagging: FLAG or rho1D4 tags at N- or C-termini facilitate immunoaffinity purification .

  • Purification Yield: For related ORs like hOR1A1, ~1.6 mg monomeric receptor can be purified from 60 T175 flasks using anti-FLAG chromatography and gel filtration .

Functional validation often employs calcium imaging or cAMP assays to confirm ligand-induced signaling .

Functional Characteristics

While OR8K1’s specific ligands remain unidentified, insights from homologous receptors suggest:

  • Ligand Diversity: ORs generally recognize structurally related odorants with micromolar affinity. For example, OR1A1 binds dihydrojasmone (KdμK_d \approx \muM) .

  • Assay-Dependent Responses: Activity may vary between cell lines (e.g., HEK293 vs. LNCaP) .

  • Metal Ion Dependence: Some ORs require zinc or copper ions for ligand binding, though OR8K1’s metal coordination sites are uncharacterized .

Research Challenges

  • Low Functional Expression: <10% of ORs express robustly in heterologous systems without chaperones .

  • Deorphanization: Only ~10% of human ORs have known ligands, necessitating high-throughput screening .

  • Structural Data: No resolved structures exist for OR8K1; homology modeling remains critical .

Applications and Future Directions

  • Biosensors: Recombinant OR8K1 could be integrated into electronic noses for odorant detection .

  • Drug Discovery: ORs are explored as targets for neurodegenerative diseases linked to olfactory dysfunction .

  • Evolutionary Studies: Comparative genomics reveal OR8K1’s conservation across mammals, hinting at conserved functional roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR8K1; Olfactory receptor 8K1; Olfactory receptor OR11-182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8K1
Target Protein Sequence
MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN KEVKDALKRTLTNRFKIPI
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14831

KEGG: hsa:390157

STRING: 9606.ENSP00000279783

UniGene: Hs.553748

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 8K1 and what is its role in the human olfactory system?

Olfactory receptor 8K1 (OR8K1), also known as Olfactory receptor OR11-182, is a member of the G-protein-coupled receptor (GPCR) family involved in odorant detection in humans. Like other olfactory receptors, OR8K1 plays a crucial role in detecting specific odorant molecules present in the surrounding environment . Olfactory receptors constitute the largest transmembrane protein family in the human genome and function by initiating neuronal responses upon interaction with odorant molecules, which ultimately triggers the perception of smell . OR8K1 is one of approximately 400 different functional olfactory receptors in humans that collectively create a repertoire of responses to various odorants, allowing for the discrimination between thousands of different smells . The receptor is encoded by the OR8K1 gene (GeneID: 390157) and is primarily expressed in olfactory sensory neurons .

What is the molecular structure and cellular localization of OR8K1?

OR8K1 is a multi-pass membrane protein located in the cell membrane with a molecular weight of approximately 36.6-37 kDa . Like other olfactory receptors, it possesses a 7-transmembrane domain structure, which is characteristic of G-protein-coupled receptors . The full-length protein consists of 319 amino acids, with both extracellular and intracellular domains that contribute to its functionality . The amino acid sequence includes specific regions for odorant binding and G-protein interaction, crucial for signal transduction following odorant detection . The protein adopts a specific conformation in the membrane that allows it to interact with both extracellular odorant molecules and intracellular signaling components .

What databases and resources provide information on OR8K1?

Researchers can access information about OR8K1 through several databases and resources:

  • UniProt: Primary accession number Q8NGG5, with secondary accession numbers B9EJB1, Q6IFC3, and Q96RC1

  • HGNC (HUGO Gene Nomenclature Committee): ID 14831

  • KEGG (Kyoto Encyclopedia of Genes and Genomes): hsa:390157

  • STRING (protein-protein interaction database): 9606.ENSP00000279783

  • UniGene: Hs.553748

These resources provide valuable information on protein sequence, structure, function, interactions, and evolutionary relationships that can guide experimental design and data interpretation in OR8K1 research.

What expression systems are effective for producing recombinant human OR8K1?

Based on current research, several expression systems have been used successfully for the production of recombinant olfactory receptors, which can be applied to OR8K1:

  • Mammalian cell systems: HEK293S cells with tetracycline-inducible expression have been effectively used for the expression of human olfactory receptors . This system is particularly valuable for functional studies as it maintains proper protein folding and post-translational modifications.

  • Yeast, E. coli, and baculovirus systems: These have also been utilized for the production of recombinant OR8K1, each with specific advantages depending on research needs .

  • TAR-Tat enhancement system: Recent research demonstrates that utilizing the TAR-Tat system, which increases transcription efficiency through positive feedback, can significantly enhance functional expression of human olfactory receptors in heterologous cells . This system has shown promise for improving both the cell surface expression and functional response to odorants.

For optimal expression, modifications such as adding epitope tags (e.g., N-terminal FLAG and C-terminal rho1D4) have proven helpful for detection and purification purposes .

What are the challenges in expressing functional OR8K1 and how can they be overcome?

Expressing functional human olfactory receptors, including OR8K1, in heterologous systems presents several challenges:

  • Poor cell surface expression: Olfactory receptors often fail to efficiently transport to the cell membrane in heterologous expression systems .

  • Protein misfolding: The complex structure of ORs can lead to misfolding when expressed outside their native environment .

  • Limited sensitivity: Even when expressed, detecting functional responses can be difficult due to low sensitivity .

Recent advances to overcome these limitations include:

  • Enhanced transcription: Increasing the transcriptional level using systems like the TAR-Tat approach has resulted in significant improvements in both cell surface expression and functional activity of human ORs . This system utilizes a positive feedback mechanism to amplify transcription efficiency.

  • Epitope tagging strategies: Adding specific tags, such as FLAG and rho1D4, can improve protein detection and purification while maintaining functionality .

  • Optimized detergent selection: For purification of functional receptors, careful selection of detergents that maintain proper protein folding is essential .

  • Stable cell line generation: Developing stable, inducible cell lines rather than transient expression systems can provide more consistent expression levels .

What purification methods yield high-quality recombinant OR8K1 for structural and functional studies?

Effective purification of recombinant OR8K1 involves several critical steps:

  • Affinity chromatography: A two-step purification protocol has been successfully employed for human olfactory receptors, which can be adapted for OR8K1 :

    • Initial purification using monoclonal anti-FLAG immunoaffinity chromatography for receptors tagged with FLAG epitope

    • Secondary purification through gel filtration to separate different oligomeric states

  • Size exclusion chromatography (SEC): SEC combined with multi-angle light scattering analysis allows for the separation and characterization of monomeric and dimeric forms of the receptor . This approach has been shown to effectively isolate different oligomeric states of human ORs.

  • Detergent optimization: The choice of detergent is crucial for maintaining receptor stability and functionality during purification. Detergent-solubilized receptors have been successfully purified while retaining their ability to bind cognate odorants .

For quality assessment of purified receptor, circular dichroism analysis can confirm proper folding of the protein, while intrinsic tryptophan fluorescence assays can be used to verify ligand binding capability .

How can the ligand binding properties of OR8K1 be experimentally determined?

Several methodologies can be employed to characterize the ligand binding properties of OR8K1:

  • Intrinsic tryptophan fluorescence assay: This technique allows for the quantification of ligand binding to detergent-solubilized receptors. The natural fluorescence of tryptophan residues in the receptor changes upon ligand binding, providing a direct measurement of binding affinity . Studies with human olfactory receptors have demonstrated that this method can determine binding affinities in the micromolar range.

  • Real-time cAMP assays: Since OR8K1 is a G-protein-coupled receptor that signals through cAMP pathways, measuring changes in intracellular cAMP levels upon odorant exposure provides functional evidence of receptor activation . This approach has been used to analyze the functional activity of heterologously expressed human ORs in HEK293S cells.

  • Calcium imaging: Another functional approach involves monitoring calcium flux in response to receptor activation, which can be visualized using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators .

  • Surface plasmon resonance (SPR): For more detailed binding kinetics, purified receptor can be immobilized on sensor chips to measure association and dissociation rates with potential ligands.

What are the known odorant specificities of OR8K1 and related olfactory receptors?

While the specific odorant profile of OR8K1 is not fully characterized in the provided search results, studies on related human olfactory receptors provide insights into odorant recognition patterns:

  • Variability in response profiles: Functional studies have demonstrated that the OR family includes members that respond to a large set of odorants (broadly tuned) and members that are activated by a relatively small number of related odorants (narrowly tuned) .

  • n-Hexanal as a ligand: Recent research has identified n-hexanal as a ligand for several human olfactory receptors. Interestingly, n-hexanal can act as either an agonist or an inverse agonist depending on the specific receptor .

  • Dihydrojasmone binding: Studies have shown that some human ORs, such as hOR1A1, bind to the odorant dihydrojasmone with affinities in the micromolar range . This suggests that similar methodologies could be applied to identify specific ligands for OR8K1.

  • Structure-activity relationships: The molecular mechanisms governing receptor-ligand interactions involve specific structural features that determine binding specificity and affinity . Identifying these features for OR8K1 would provide valuable insights into its function.

What signal transduction pathways are activated by OR8K1 stimulation?

OR8K1, like other olfactory receptors, functions as a G-protein-coupled receptor (GPCR) that transduces odorant binding into intracellular signaling events:

  • G-protein coupling: Upon odorant binding, OR8K1 likely activates G proteins, particularly Golf, which is the predominant G protein in olfactory sensory neurons .

  • cAMP signaling pathway: Activation of Golf stimulates adenylyl cyclase, leading to increased production of cyclic AMP (cAMP) . This pathway is central to olfactory signal transduction and can be monitored using real-time cAMP assays to assess receptor functionality.

  • Calcium signaling: The cAMP increase leads to opening of cyclic nucleotide-gated channels, resulting in calcium influx. This calcium signal can be measured as a functional readout of receptor activation .

  • Receptor adaptation and desensitization: Like other GPCRs, OR8K1 likely undergoes processes of adaptation and desensitization following prolonged or repeated stimulation, which may involve receptor phosphorylation and β-arrestin recruitment.

Understanding these signaling pathways is crucial for designing functional assays and interpreting results in OR8K1 research.

What structural information is currently available for OR8K1 and how can new structural data be obtained?

  • Crystallography and NMR potential: The successful purification of human olfactory receptors in properly folded conformations, as demonstrated for hOR1A1, paves the way for future crystallographic and NMR studies . Similar approaches could be applied to OR8K1.

  • Circular dichroism (CD) analysis: CD has been used to confirm proper folding of purified human olfactory receptors and provides information about secondary structure composition . This technique could provide initial structural characterization of OR8K1.

  • Size exclusion chromatography-multi-angle light scattering (SEC-MALS): This technique has been used to determine the oligomeric state of human ORs, revealing the presence of both monomeric and dimeric forms . Similar analysis could determine if OR8K1 exists in multiple oligomeric states.

  • Computational modeling: In the absence of experimental structures, homology modeling based on related GPCRs can provide insights into the potential structure of OR8K1 and guide experimental design.

To obtain new structural data for OR8K1, researchers could:

  • Optimize expression and purification protocols specifically for OR8K1 based on successful approaches with other human ORs

  • Explore the use of stabilizing mutations or fusion partners to enhance crystallization potential

  • Consider cryo-electron microscopy as an alternative to crystallography for structural determination

  • Employ hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

How do structural features of OR8K1 correlate with its odorant binding specificity?

While specific structural details of OR8K1's binding pocket are not explicitly described in the provided search results, general principles regarding structure-function relationships in olfactory receptors can be applied:

  • Transmembrane domain involvement: The odorant binding pocket in olfactory receptors is typically formed by the transmembrane domains, with specific amino acid residues creating a binding environment that determines odorant specificity .

  • Key binding residues: Particular amino acids within the transmembrane regions likely contribute to recognition of specific odorant features, such as functional groups, chain length, and molecular shape .

  • Conformational changes upon binding: Odorant binding induces conformational changes in the receptor that allow for G-protein activation. These structural rearrangements are critical for signal transduction .

  • Monomeric vs. dimeric states: The presence of both monomeric and dimeric forms of human olfactory receptors, as demonstrated through SEC-MALS analysis, suggests that oligomerization may play a role in receptor function . How these different states affect ligand binding specificity remains an important question for OR8K1 research.

To correlate structural features with binding specificity, researchers could employ site-directed mutagenesis of predicted binding pocket residues combined with functional assays to identify key determinants of odorant recognition.

How can antibodies against OR8K1 be effectively utilized in research applications?

Several research applications for OR8K1 antibodies have been demonstrated or can be inferred from the search results:

  • Immunofluorescence (IF): Anti-OR8K1 antibodies can be used to visualize the cellular localization and expression patterns of the receptor in various tissues or cell culture systems . This technique is particularly valuable for studying the trafficking and membrane insertion of the receptor.

  • Western blotting (WB): Antibodies enable detection of OR8K1 protein expression levels and can confirm the presence of the correctly sized protein (approximately 36.6-37 kDa) . This application is useful for validating expression systems and purification protocols.

  • ELISA (Enzyme-Linked Immunosorbent Assay): OR8K1 antibodies can be employed in ELISA assays for quantitative detection of the protein in various samples . This method provides a sensitive means to measure expression levels across different conditions.

  • Immunoprecipitation: Although not explicitly mentioned in the search results, antibodies could be used for immunoprecipitation studies to isolate OR8K1 and identify interacting proteins.

  • Flow cytometry (FC): Some antibodies against related proteins have been used in flow cytometry applications, suggesting this technique could be applied to study OR8K1 expression in cell populations .

For optimal results, researchers should consider:

  • Using antibodies validated for specific applications (the search results indicate recommended dilutions for different techniques)

  • Selecting the appropriate antibody type (polyclonal vs. monoclonal) based on the research question

  • Verifying specificity through appropriate controls

What novel technologies are advancing the study of human olfactory receptors including OR8K1?

Recent technological advances that are enhancing the study of human olfactory receptors include:

  • TAR-Tat transcriptional enhancement system: This innovative approach employs a positive feedback mechanism to increase the transcriptional efficiency of olfactory receptors, resulting in significantly improved cell surface expression and functional responses to odorants . This system has demonstrated success with several human ORs (OR1A1, OR6N2, and OR51M1) and could be applied to OR8K1.

  • Advanced heterologous expression systems: Stable tetracycline-inducible cell lines have improved the consistent expression of human ORs . These systems allow for controlled induction of receptor expression at desired time points.

  • Receptor engineering strategies: Addition of epitope tags (such as FLAG and rho1D4) at specific positions has facilitated detection and purification while maintaining functionality .

  • Real-time functional assays: Sophisticated assays for measuring receptor activation in real-time, such as cAMP dynamics and calcium signaling, provide sensitive means to detect responses to potential odorants .

  • Structural biology techniques: Progress in membrane protein crystallization, cryo-electron microscopy, and NMR spectroscopy is beginning to make structural studies of these challenging receptors more feasible .

These technological advances collectively promise to accelerate understanding of OR8K1 and other human olfactory receptors by overcoming traditional obstacles in expression, purification, and functional characterization.

How can OR8K1 research contribute to understanding broader olfactory coding principles?

Research on individual olfactory receptors like OR8K1 can provide significant insights into how the human olfactory system encodes and discriminates between thousands of different odorants:

  • Decoding the olfactory repertoire: Humans possess approximately 400 different functional olfactory receptors that collectively create a combinatorial code for odor perception . Understanding the response profile of each receptor, including OR8K1, contributes to deciphering this complex coding system.

  • Agonist vs. inverse agonist relationships: Recent research has revealed that the same odorant can act as an agonist for some receptors and an inverse agonist for others, as demonstrated with n-hexanal . Characterizing such relationships for OR8K1 would enhance understanding of how conflicting signals might be integrated in the olfactory system.

  • Structure-function correlations: Elucidating the structural basis for odorant recognition by OR8K1 would contribute to broader principles regarding how molecular features of odorants are detected by the receptor repertoire .

  • Receptor sensitivity and dynamics: Studying the sensitivity, specificity, and signaling dynamics of OR8K1 can provide insights into the temporal aspects of odor coding and how the olfactory system maintains sensitivity across vast concentration ranges.

  • Evolutionary perspectives: Comparative studies of OR8K1 with orthologous receptors in other species could reveal evolutionary adaptations in olfactory function and inform our understanding of how olfactory preferences are shaped by environmental factors.

By contributing detailed molecular and functional data on individual receptors like OR8K1, researchers can build toward a comprehensive model of how the entire olfactory system encodes chemical information into meaningful perceptions.

What are common issues in OR8K1 expression systems and how can they be resolved?

Researchers working with OR8K1 and other human olfactory receptors typically encounter several challenges in expression systems:

  • Low surface expression level: Human olfactory receptors are often poorly expressed on the surface of heterologous cells .

    • Solution: Implement the TAR-Tat system to enhance transcriptional efficiency, which has been shown to significantly increase both cell surface expression and functional activity of human ORs .

    • Alternative approach: Optimize codon usage for the expression system and consider adding trafficking enhancement sequences.

  • Protein misfolding: Improper folding can lead to aggregation and retention in the endoplasmic reticulum.

    • Solution: Express the receptor at lower temperatures (e.g., 30°C instead of 37°C) and include molecular chaperones that aid in proper folding.

    • Verification method: Use circular dichroism analysis to confirm proper folding of the purified receptor .

  • Inconsistent expression levels: Variation between experiments can complicate data interpretation.

    • Solution: Develop stable inducible cell lines rather than relying on transient transfection . The tetracycline-inducible system allows for controlled expression timing and levels.

  • Poor functional responses: Even when expressed, receptors may show weak responses to odorants.

    • Solution: Increase transcriptional levels as demonstrated with the TAR-Tat system, which enhances functional responses to odorants .

    • Analytical approach: Use highly sensitive assays such as real-time cAMP measurements to detect subtle responses .

What factors affect the stability and solubility of purified OR8K1?

Several critical factors influence the stability and solubility of purified OR8K1 and related olfactory receptors:

  • Detergent selection: The choice of detergent is crucial for maintaining receptor stability during solubilization and purification.

    • Optimal approach: Test multiple detergents and detergent mixtures to identify those that maintain the receptor in a properly folded, functional state .

    • Evaluation method: Assess functionality through ligand binding assays, such as intrinsic tryptophan fluorescence, to ensure the purified receptor retains its binding capability .

  • Buffer composition: pH, salt concentration, and presence of stabilizing agents significantly impact receptor stability.

    • Recommendation: Include glycerol (e.g., 50%) in storage buffers to help maintain protein stability .

    • Consideration: Optimize buffer components based on the specific downstream applications (structural studies, binding assays, etc.).

  • Temperature sensitivity: Membrane proteins including ORs are often temperature-sensitive during purification and storage.

    • Storage guidance: Store purified receptor at -20°C for short-term or -80°C for extended storage . Avoid repeated freeze/thaw cycles as they can lead to protein denaturation .

  • Oligomeric state: Human olfactory receptors can exist in both monomeric and dimeric forms, which may have different stability profiles .

    • Analysis method: Use size exclusion chromatography-multi-angle light scattering (SEC-MALS) to separate and characterize different oligomeric states .

    • Quantitative data: Previous work with human ORs yielded approximately 1.6 mg of monomeric and 1.1 mg of dimeric forms from sixty T175 flasks .

How does OR8K1 compare structurally and functionally to other human olfactory receptors?

While the search results do not provide direct comparisons between OR8K1 and other specific olfactory receptors, several general principles can be inferred:

  • Sequence homology: As a member of the olfactory receptor family, OR8K1 likely shares sequence similarities with other human ORs, particularly in the transmembrane domains that are critical for receptor function .

  • Functional diversity: Human olfactory receptors exhibit diverse response profiles, with some responding to a wide range of odorants and others being more narrowly tuned . The specific breadth of OR8K1's response spectrum would be a valuable area for comparative investigation.

  • Oligomeric states: Like other human ORs that have been studied (such as hOR1A1), OR8K1 may exist in both monomeric and dimeric forms, which could influence its functional properties .

  • Ligand binding affinities: Different olfactory receptors exhibit varying affinities for their cognate odorants. Some human ORs have been shown to bind odorants with affinities in the micromolar range , providing a benchmark for comparing OR8K1's binding properties.

  • Transcriptional enhancement responses: The TAR-Tat system has demonstrated varying degrees of enhancement across different human ORs (OR1A1, OR6N2, and OR51M1 showed robust enhancement) . Testing this system with OR8K1 would provide comparative data on its responsiveness to transcriptional enhancement.

What bioinformatic tools and databases are most useful for OR8K1 research?

Based on the search results and general research practices in the field, several bioinformatic resources are particularly valuable for OR8K1 research:

  • Protein databases:

    • UniProt (Q8NGG5): Provides comprehensive protein sequence information, functional annotations, and cross-references

    • Protein Data Bank (PDB): Essential for structural information, though specific OR8K1 structures may not yet be available

  • Genomic resources:

    • HGNC (ID 14831): Human Gene Nomenclature database for standardized gene information

    • KEGG (hsa:390157): Offers pathway mapping and functional annotation data

  • Interaction databases:

    • STRING (9606.ENSP00000279783): Provides protein-protein interaction networks that may include OR8K1

  • Sequence analysis tools:

    • BLAST: For identifying sequence homologies with other olfactory receptors

    • Multiple sequence alignment tools: For comparative analysis of conserved regions across olfactory receptors

    • Transmembrane prediction algorithms: To identify the seven transmembrane domains characteristic of GPCRs

  • Structural prediction resources:

    • Homology modeling servers: For generating structural models based on related GPCRs

    • Molecular docking software: To predict potential odorant binding modes and affinities

  • Functional genomics databases:

    • Gene Expression Omnibus (GEO): For expression data across tissues and conditions

    • UniGene (Hs.553748): For tissue expression patterns

These resources collectively enable comprehensive analysis of OR8K1 from sequence to structure to function, facilitating integrated research approaches.

How can OR8K1 research be integrated with broader neurosensory studies?

OR8K1 research can be meaningfully integrated with broader neurosensory studies in several ways:

  • Olfactory coding principles: Detailed characterization of OR8K1's response profile contributes to understanding how the approximately 400 human olfactory receptors collectively encode thousands of different odorants through combinatorial activation patterns . This information is essential for deciphering the principles of olfactory coding at the receptor level.

  • Signal integration in the olfactory bulb: Understanding how signals from OR8K1-expressing neurons are processed in the olfactory bulb provides insights into the initial stages of central olfactory processing. This includes investigating the specific glomeruli where OR8K1-expressing neurons project.

  • Perception studies: Correlating OR8K1 activation with perceptual outcomes in human subjects can help establish connections between molecular recognition events and conscious olfactory experiences. This may include studying individuals with specific genetic variants of OR8K1.

  • Comparative neurobiology: Examining the evolution and function of OR8K1 orthologs across species can reveal how genetic adaptations in olfactory receptors relate to ecological niches and behavioral requirements.

  • Clinical applications: Investigating the role of OR8K1 in olfactory disorders could contribute to understanding conditions such as specific anosmias (inability to smell certain odorants) or broader olfactory dysfunction.

  • Multisensory integration: Exploring how olfactory information from OR8K1 and other receptors is integrated with other sensory modalities (taste, trigeminal) provides a more comprehensive view of chemosensory perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.