Recombinant Human Olfactory receptor 8K5 (OR8K5)

Shipped with Ice Packs
In Stock

Description

Introduction to OR8K5

Olfactory receptor 8K5 (OR8K5) is a member of the class A rhodopsin-like G protein-coupled receptor (GPCR) family, specifically classified under the tetrapod-specific odorant receptor family (class O2) . Encoded by the OR8K5 gene (NCBI RefSeq: NP_001004058.2), it is one of approximately 400 functional olfactory receptors in humans, tasked with detecting volatile odorants and transmitting signals to the brain .

IdentifierValue
UniProt IDQ8NH50
RefSeq AccessionNP_001004058.2
Gene SymbolOR8K5
Family/SubfamilyOdorant Receptor 8 (OR8K5)

Functional Mechanism and Ligand Binding

OR8K5, like other olfactory receptors, is hypothesized to detect odorants via a combinatorial code, where multiple receptors respond to overlapping ligand sets . Key steps include:

  1. Odorant Binding: Putative interaction with small hydrophobic/polar molecules in the binding pocket.

  2. G Protein Activation: Coupling to Gαolf or Gαs, triggering adenylyl cyclase activity and cAMP production .

  3. Signal Transduction: Depolarization of olfactory sensory neurons via cyclic nucleotide-gated ion channels .

Known Challenges:

  • Ligand Specificity: No physiological ligands are reported for OR8K5 in public databases (GPCRdb, M2OR) .

  • Metalloprotein Interactions: While copper-dependent binding is observed in some olfactory receptors (e.g., MOR244-3 for thiols), OR8K5’s involvement remains uncharacterized .

Expression and Localization

AspectDetails
Tissue ExpressionPrimarily olfactory epithelium
Cellular LocalizationPlasma membrane of olfactory sensory neurons
Non-Olfactory RolesPotential expression in prostate or other tissues (inferred from OR51E2 studies)

Note: Direct experimental data on OR8K5 expression is limited.

Research Findings and Deorphanization Status

  • Deorphanization: OR8K5 remains an orphan receptor, with no ligands identified in functional assays .

  • Comparative Insights:

    ReceptorLigandBinding Mechanism
    OR51E2Propionic acidEnclosed pocket, polar/hydrophobic interactions
    OR5K1PyrazinesSelective activation via conserved motifs
    OR8K5N/APending experimental validation

Experimental Approaches for Study

Challenges in OR8K5 Research:

  • Low Expression: Olfactory receptors exhibit poor solubility and stability in heterologous systems (e.g., HEK293, Xenopus oocytes) .

  • Assay Bias: Ligand detection may require specialized cell lines (e.g., prostate carcinoma cells) .

Proposed Strategies:

  1. Recombinant Expression: Use of insect cells or mammalian systems with chaperones for proper folding.

  2. Ligand Screening: High-throughput assays using odorant libraries (e.g., volatile organic compounds).

  3. Molecular Dynamics: Simulations to predict binding pockets and ligand interactions .

Potential Applications

  • Disease Biomarkers: Olfactory receptors like OR51E2 are implicated in neurodegenerative diseases; OR8K5 may offer similar insights .

  • Drug Development: Targeting olfactory receptors for therapeutic intervention (e.g., anosmia treatment).

  • Sensory Research: Understanding chemosensory diversity in humans.

References

  1. Wikipedia (2025): Olfactory Receptor.

  2. PubChem (2025): Olfactory Receptor 8K5 (Q8NH50).

  3. Frontiers in Molecular Biosciences (2024): Structural mechanisms of olfactory receptors.

  4. PMC (2025): Binding pocket analysis of OR51E2.

  5. GPCRdb (2025): OR8K5 entry.

  6. PMC (2023): M2OR database for odorant-receptor pairs.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
OR8K5; Olfactory receptor 8K5; Olfactory receptor OR11-174
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8K5
Target Protein Sequence
MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMY FSIRHLAFVDLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAY DRYVAICNPLLYYVIMSQRLCHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCD DVPLLPMLCSNAQEIELLSILFSVFNLISSFLIVLVSYMLILLAICQMHSAEGRKKAFST CGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNA FYKLFEN
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15315

KEGG: hsa:219453

STRING: 9606.ENSP00000323853

UniGene: Hs.553626

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 8K5 (OR8K5) and what is its function in humans?

Olfactory Receptor 8K5 (OR8K5) belongs to the family of olfactory receptors, which are class A G-protein-coupled receptors that play a crucial role in detecting odorant molecules present in the surrounding environment. These receptors constitute the largest transmembrane protein family in the human genome . OR8K5 specifically belongs to family 8, subfamily K, and is the fifth member of this subfamily. Like other olfactory receptors, OR8K5 is likely involved in the detection and discrimination of specific odorants, contributing to the complex process of smell perception. The receptor functions through signal transduction pathways that typically involve G-protein activation and subsequent cAMP production when the receptor binds to its cognate odorant molecules . Current research suggests that different olfactory receptors exhibit varying levels of specificity, with some responding to a broad range of odorants while others are activated by only a limited number of structurally related compounds.

Receptor PropertyOR8K5 Characteristics
ClassificationClass A G-protein-coupled receptor
FamilyOlfactory receptor family 8, subfamily K, member 5
Primary FunctionDetection of specific odorant molecules
Signal TransductionG-protein mediated cAMP pathway activation
ExpressionPrimarily in olfactory epithelium

What methods are available for detecting OR8K5 in research samples?

Several methodological approaches are available for detecting OR8K5 in research samples. Enzyme-linked immunosorbent assay (ELISA) represents one of the most widely used techniques for quantitative detection of OR8K5 in various sample types. Commercial ELISA kits for OR8K5 detection offer sensitivity ranges typically between 50-1000 pg/mL with minimum detection limits around 50 pg/mL . These assays can be applied to various sample types including serum, plasma, tissue homogenates, and cell culture supernatants . For researchers requiring more qualitative assessments of OR8K5 expression, immunohistochemistry and immunofluorescence using specific antibodies against OR8K5 can provide spatial information about receptor localization within tissues. Additionally, reverse transcription polymerase chain reaction (RT-PCR) and quantitative PCR (qPCR) can be employed to detect OR8K5 at the mRNA level, which is particularly useful for expression studies.

How is recombinant Human OR8K5 typically produced for research purposes?

Production of recombinant human OR8K5 typically employs heterologous expression systems similar to those used for other olfactory receptors. The most common approach involves stable tetracycline-inducible cell lines, such as HEK293S, which have been successfully used for other olfactory receptors . For effective production, the OR8K5 gene sequence is typically optimized for the expression host and engineered to include epitope tags that facilitate detection and purification. Common epitope tags include the C-terminal rho1D4 epitope tag and N-terminal FLAG epitope tag . The expression vector containing the engineered OR8K5 sequence is then transfected into the host cells, and protein expression is induced under controlled conditions. Following expression, the membrane-bound receptor must be carefully solubilized using appropriate detergents that maintain protein structure and function. This step is particularly critical for olfactory receptors, which are highly hydrophobic membrane proteins that can easily lose their native conformation during solubilization.

What sample types can be used in OR8K5 research?

Multiple sample types can be utilized in OR8K5 research, each offering unique advantages depending on the specific research questions. Common sample types include cell culture supernatant, plasma, serum, and tissue homogenates, all of which are compatible with available detection methods such as ELISA . For expression studies, nasal epithelial tissue samples represent the physiologically relevant source, as this is where olfactory receptors are primarily expressed. Researchers conducting functional studies often rely on heterologous expression systems such as HEK293 cells transfected with OR8K5 expression constructs. These systems allow for controlled expression and manipulation of the receptor in a defined cellular environment. For structural studies, purified protein samples obtained from large-scale expression systems are required, with detergent-solubilized receptor representing the typical preparation method for membrane proteins like OR8K5 .

What are the fundamental components needed for OR8K5 detection assays?

Effective OR8K5 detection assays require several key components, particularly for ELISA-based methods. These typically include: a 96-well microtiter plate coated with specific antibodies, enzyme conjugates for signal generation, standard solutions of known OR8K5 concentrations for calibration, substrate solutions for the enzyme reaction, stop solutions to terminate the reaction, wash solutions to remove unbound materials, and balance solutions to maintain optimal pH and ionic conditions . Beyond these reagents, researchers must also have access to precision pipettors and disposable tips, measuring cylinders, distilled or deionized water, tubes for sample dilution, absorbent paper, and a microplate reader capable of measuring absorbance at specific wavelengths (typically 450 nm for colorimetric assays) . Additionally, centrifugation equipment capable of 3000 x g, microplate washers or washing bottles, and incubators maintained at appropriate temperatures (usually 37°C) are essential for proper assay execution.

What experimental designs are most effective for studying OR8K5 ligand interactions?

The experimental design should implement proper controls and randomization to minimize the impact of extraneous variables . Statistical power analyses should be conducted prior to experimentation to determine appropriate sample sizes. The design should also incorporate multiple ligand concentrations to enable the construction of dose-response curves and determination of binding affinities. For complex multi-attribute experiments, factors must be controlled to prevent confounding correlations .

How can researchers address challenges in expressing functional recombinant OR8K5?

Expression of functional recombinant OR8K5 presents several challenges common to membrane proteins, particularly G-protein-coupled receptors. Addressing these challenges requires a multifaceted approach. First, codon optimization of the OR8K5 gene sequence for the expression host can significantly improve translation efficiency. Second, the incorporation of N-terminal signal sequences and C-terminal tags can enhance membrane targeting and facilitate subsequent purification. Third, the use of inducible expression systems, such as tetracycline-inducible HEK293S cell lines, allows for controlled expression that can mitigate potential toxicity associated with membrane protein overexpression .

Another critical consideration is the inclusion of molecular chaperones or chemical chaperones in the expression system, which can promote proper folding of the receptor. The addition of ligands during expression may also stabilize the receptor in its native conformation. For solubilization and purification, screening multiple detergents is essential to identify conditions that maintain receptor structure and function. A two-step purification strategy, such as the combination of monoclonal anti-FLAG immunoaffinity purification followed by gel filtration, has proven effective for other olfactory receptors and may be applicable to OR8K5 . Size exclusion chromatography coupled with multi-angle light scattering can help verify the oligomeric state of the purified receptor, which is crucial information for functional studies.

What analytical methods provide the most reliable data for OR8K5 binding assays?

Reliable analytical methods for OR8K5 binding assays must balance sensitivity, specificity, and reproducibility. Intrinsic tryptophan fluorescence assay has been successfully employed for other olfactory receptors to quantify ligand binding with affinities in the micromolar range . This technique relies on changes in the fluorescence properties of tryptophan residues within the receptor when a ligand binds, providing a direct measure of interaction without the need for additional labels or reporters. Surface plasmon resonance (SPR) represents another valuable technique that allows real-time monitoring of binding kinetics, providing association and dissociation rate constants in addition to equilibrium binding constants.

For functional assays that measure receptor activation rather than just binding, real-time cAMP assays offer high sensitivity and temporal resolution . These assays detect changes in intracellular cAMP levels following receptor activation, providing a physiologically relevant readout of receptor function. Alternative approaches include calcium imaging, which measures calcium flux upon receptor activation, and bioluminescence resonance energy transfer (BRET) assays, which can detect conformational changes in the receptor or interactions with downstream signaling partners. Each of these methods has specific advantages and limitations, and researchers should select the most appropriate technique based on their specific research questions and available resources.

How does OR8K5 compare structurally and functionally to other olfactory receptors?

What are the current approaches for characterizing the structure of OR8K5?

Computational approaches also offer valuable structural insights. Homology modeling based on the crystal structures of other class A G-protein-coupled receptors can generate theoretical models of OR8K5 structure. Molecular dynamics simulations can then refine these models and provide information about dynamic aspects of receptor function, such as conformational changes associated with ligand binding. Site-directed mutagenesis studies, combined with functional assays, can experimentally validate these computational models by identifying residues critical for ligand binding or signal transduction. The ultimate goal would be to obtain high-resolution structural data through X-ray crystallography or NMR studies, which would require the production of sufficient quantities of pure, homogeneous, and properly folded receptor protein .

Structural Characterization MethodInformation ProvidedTechnical Challenges
Circular DichroismSecondary structure content, proper foldingRequires purified protein, limited resolution
Size Exclusion Chromatography-Multi-Angle Light ScatteringOligomeric state, homogeneityRequires purified protein, detergent interference
Cryo-Electron Microscopy3D structure at near-atomic resolutionComplex sample preparation, high equipment costs
Homology ModelingTheoretical 3D structure based on related proteinsAccuracy depends on template quality
Site-Directed MutagenesisFunctional relevance of specific residuesLabor-intensive, indirect structural information
X-ray CrystallographyHigh-resolution 3D structureExtremely challenging for membrane proteins

How should researchers analyze and interpret data from OR8K5 experiments?

Data analysis and interpretation for OR8K5 experiments require rigorous statistical approaches and careful consideration of experimental variables. When analyzing ELISA data for OR8K5 detection, standard curves should be constructed using known concentrations, typically ranging from 50-1000 pg/mL . Linear or non-linear regression analysis is then applied to determine sample concentrations from measured absorbance values. For ligand binding studies, data should be fitted to appropriate binding models (e.g., one-site binding, competitive binding) to extract parameters such as dissociation constants (Kd) or inhibition constants (Ki). Functional assays measuring receptor activation require dose-response analysis to determine EC50 values (the concentration producing 50% of the maximal response).

Proper data tables are essential for clear presentation of results. These tables should include a descriptive title, clearly labeled columns with units and measurement uncertainty, and consistent precision in reported values . For example:

Sample TypeOR8K5 Concentration (pg/mL)Standard DeviationNumber of Replicates
Serum342.618.76
Plasma328.921.46
Tissue Homogenate567.232.56

Statistical analysis should account for experimental design considerations, particularly the control of extraneous variables that might influence results . Researchers should clearly distinguish between independent variables (those manipulated in the experiment) and dependent variables (the measured outcomes) . Appropriate statistical tests should be selected based on the experimental design and data distribution, with particular attention to sample size, normalization methods, and multiple comparison corrections.

What approaches can resolve contradictory findings in OR8K5 research?

Contradictory findings in OR8K5 research can stem from various sources, including differences in experimental methods, expression systems, or analytical techniques. Resolving such contradictions requires a systematic approach. First, researchers should carefully examine methodological differences between studies, paying particular attention to the expression systems used, purification methods, and assay conditions. Different detergents used during solubilization can significantly impact receptor structure and function, potentially leading to contradictory results . Similarly, the presence or absence of specific epitope tags may influence receptor behavior.

Meta-analysis of available data can help identify patterns and sources of variability across studies. This approach requires standardization of data from different sources and statistical methods that account for between-study heterogeneity. Collaborative replication studies involving multiple laboratories following standardized protocols can also help resolve contradictions by distinguishing between genuine biological variability and methodological artifacts. When designing such studies, researchers should carefully control potentially confounding variables and ensure adequate statistical power . The experimental design should include appropriate randomization and blinding procedures to minimize bias .

For particularly persistent contradictions, orthogonal approaches that measure the same phenomenon using different techniques can provide valuable insights. For example, if binding studies using different methods yield contradictory results, combining multiple techniques such as intrinsic tryptophan fluorescence, surface plasmon resonance, and functional assays may help establish a consensus.

What are the promising areas for future OR8K5 research?

Several promising areas for future OR8K5 research emerge from current limitations in understanding this receptor. First, comprehensive deorphanization studies to identify the natural ligands of OR8K5 would provide fundamental insights into its physiological role. This would involve screening diverse odorant libraries using functional assays such as real-time cAMP measurements or calcium imaging in heterologous expression systems. Second, structural biology approaches, including X-ray crystallography, NMR spectroscopy, and cryo-electron microscopy, could provide high-resolution structural information that would facilitate understanding of ligand binding mechanisms and receptor activation .

Third, physiological studies exploring the expression patterns and functional significance of OR8K5 in various tissues would expand our understanding beyond traditional olfactory roles. Fourth, development of OR8K5-specific antibodies and probes would enhance detection capabilities and enable more detailed localization studies. Fifth, computational approaches combining molecular dynamics simulations with machine learning could predict novel ligands and binding modes, guiding experimental efforts. Finally, engineering approaches aimed at improving the expression, stability, and crystallizability of OR8K5 could overcome current technical barriers to structural and functional studies .

These research directions would benefit from interdisciplinary collaboration combining expertise in molecular biology, structural biology, computational modeling, and sensory neuroscience. Development of standardized protocols and reagents would facilitate comparison of results across different laboratories and accelerate progress in the field.

How might advanced technologies enhance OR8K5 research in the near future?

Advanced technologies are poised to significantly enhance OR8K5 research across multiple dimensions. Single-cell RNA sequencing technologies could provide unprecedented insights into the expression patterns of OR8K5 at the cellular level, potentially revealing previously unrecognized cell types or states where this receptor is expressed. CRISPR-Cas9 genome editing offers powerful capabilities for creating knockout or knock-in models to study OR8K5 function in vivo, as well as for introducing specific mutations to probe structure-function relationships.

In structural biology, advances in cryo-electron microscopy have revolutionized membrane protein structure determination and could enable high-resolution structures of OR8K5, particularly if coupled with novel membrane mimetics such as nanodiscs or styrene-maleic acid lipid particles (SMALPs) that maintain the receptor in a more native-like environment . Microfluidic platforms for high-throughput screening could accelerate the identification of OR8K5 ligands and modulators. Label-free detection technologies, such as advanced surface plasmon resonance systems or bio-layer interferometry, could provide detailed binding kinetics with minimal perturbation to the receptor.

Computational advances, particularly in artificial intelligence and molecular dynamics simulations, could enhance our ability to predict OR8K5 structure, dynamics, and ligand interactions. Integration of these computational approaches with experimental data through machine learning frameworks could create powerful predictive models that guide experimental design and interpretation. Together, these technological advances promise to overcome many current limitations in OR8K5 research and accelerate progress in understanding this receptor's structure, function, and physiological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.