Recombinant Human Olfactory receptor 8U1 (OR8U1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR8U1

OR8U1 (UniProt ID: Q8NH10) is a class A G-protein coupled receptor (GPCR) encoded by the OR8U1 gene (Entrez Gene ID: 219417) on human chromosome 11q12.1 . Key features include:

PropertyDescription
Protein Length309 amino acids
Molecular Weight35,088 Da
Domains7-transmembrane structure with extracellular odorant-binding regions
FunctionOdorant recognition, Gα<sub>olf</sub> protein activation, cAMP signaling

OR8U1 is expressed in olfactory sensory neurons and participates in combinatorial odor coding, enabling discrimination of diverse odorants .

Recombinant Production Methods

Recombinant OR8U1 is synthesized using heterologous expression systems to overcome challenges in native protein isolation:

Expression Systems

SystemExample ProductTagSource
E. coliFull-length OR8U1 (RFL20976HF) His-tagCreative BioMart
Mammalian CellsChicken OR8U1 (OR8U1-2844C) NativeCreative BioMart

These systems enable large-scale production for functional studies, though post-translational modifications (e.g., glycosylation) may vary .

Biochemical Roles

  • G-protein coupling: Activates adenylate cyclase via Gα<sub>olf</sub>, elevating intracellular cAMP .

  • Ligand specificity: Binds hydrophobic odorants, with affinity modulated by zinc/copper ion coordination .

Genetic Variation

OR8U1 resides in a copy-number-variable (CNV) region on 11q11. A 7.6 kb deletion generates a hybrid receptor (OR8U1) from OR8U8 and OR8U9, present in 12% of humans . This structural polymorphism may underlie individual differences in odor perception .

Detection Kits

ProductSensitivitySample TypesApplication
Abbexa ELISA Kit 0.156–10 ng/mlTissue homogenates, lysatesQuantitative analysis

Antibodies

  • PACO03654 Antibody: Targets OR8U1/OR8U8/OR8U9 for immunofluorescence (IF) and flow cytometry .

  • Epitope: Internal region (aa 150–200) .

Applications in Olfactory Research

  1. Deorphanization Studies: Screening OR8U1 against odorant libraries (e.g., M2OR database ) to identify ligands.

  2. Neurosensory Modeling: Investigating monoallelic receptor expression patterns in olfactory neurons .

  3. Disease Links: Exploring anosmia mechanisms tied to OR8U1 pseudogenization or CNV loss .

Challenges and Future Directions

  • Ligand Identification: OR8U1 remains understudied in odorant screens compared to receptors like OR1A1 .

  • Structural Biology: No resolved crystal structure exists; homology modeling remains critical .

  • Therapeutic Potential: GPCR-targeted drug design could exploit OR8U1’s signaling pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR8U1; Olfactory receptor 8U1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR8U1
Target Protein Sequence
MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA LKKIIINKN
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19611

KEGG: hsa:219417

STRING: 9606.ENSP00000304188

UniGene: Hs.553618

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 8U1 (OR8U1)?

Human Olfactory Receptor 8U1 (OR8U1) is an odorant receptor protein encoded by the OR8U1 gene in humans. It belongs to the G-protein coupled receptor 1 family, which is characterized by seven transmembrane domains . OR8U1 functions as a critical component of the olfactory system, participating in the detection and discrimination of diverse odorant molecules through signal transduction mechanisms. The receptor is expressed on the surface of olfactory sensory neurons, where it initiates signaling cascades upon binding with specific odorant ligands . As part of the broader olfactory receptor repertoire, OR8U1 contributes to the combinatorial code that allows humans to distinguish thousands of different odors with a relatively limited number of receptors.

What genomic information is available for OR8U1?

The OR8U1 gene is documented in multiple genomic databases, including RefSeq (Accession: NP_001005204.1) and Open Targets (ID: ENSG00000172199) . It belongs to the larger family of olfactory receptor genes, which constitute the largest gene family in the human genome. Like most olfactory receptor genes, OR8U1 has an intronless coding region, a characteristic feature that facilitates rapid expression. The gene is located within one of several olfactory receptor gene clusters in the human genome, which are believed to have evolved through multiple duplication events. Mutations in this gene have been cataloged in databases such as COSMIC, which tracks somatic mutations in various tissues . Genomic analysis of OR8U1 can provide insights into evolutionary relationships among olfactory receptors and potential functional specializations.

How does OR8U1 participate in the olfactory coding system?

OR8U1 contributes to olfactory perception through a sophisticated combinatorial coding mechanism. According to research on olfactory receptors, a single odorant molecule can activate multiple receptors, and conversely, a single receptor can respond to various odorant molecules . This "many-to-many" relationship forms the basis of the combinatorial code that allows humans to distinguish tens of thousands of odors despite having only a few hundred functional olfactory receptors .

Within this system, OR8U1 likely responds to a specific subset of odorant molecules with varying affinities. The collective activation pattern across multiple receptors, including OR8U1, creates a unique "odor signature" for each volatile compound. Even minor alterations in a single receptor's functionality can lead to notable perceptual consequences, highlighting the importance of understanding specific receptor-odorant interactions . The specific odorant molecules that activate OR8U1 have not been fully characterized, although databases like M2OR are working to catalog such relationships for various olfactory receptors .

What experimental systems are appropriate for studying OR8U1 function?

Investigating OR8U1 function requires specialized experimental systems that can accurately measure receptor activation. Several approaches have been developed for studying olfactory receptors:

  • Heterologous Expression Systems: Cell lines such as HEK293, HeLa, and Sf9 insect cells can be transfected with OR8U1 expression constructs along with necessary signaling components (e.g., G-proteins, Receptor Transporting Proteins) . These systems allow for controlled testing of receptor responses to potential ligands.

  • Native Olfactory Sensory Neurons (OSNs): Studies using primary cultures of OSNs expressing OR8U1 provide a more physiologically relevant context, although isolation of neurons expressing a specific receptor presents technical challenges .

  • Calcium Imaging Assays: These assays measure intracellular calcium flux as a proxy for receptor activation, offering high sensitivity for detecting OR8U1 responses to potential odorants .

  • cAMP Accumulation Assays: Since olfactory receptors typically signal through Gαolf and adenylyl cyclase, measuring cAMP production provides a direct readout of receptor activation.

  • Reporter Gene Assays: Systems incorporating luciferase or other reporter genes downstream of cAMP-responsive elements can amplify signals for better detection of receptor responses.

When designing experiments with OR8U1, considerations should include appropriate controls, concentration ranges of test compounds, and validation of receptor expression and functionality. Integration of multiple assay types is recommended for comprehensive characterization of receptor properties.

How do structural features of OR8U1 relate to its function?

The structural features of OR8U1 are typical of Class A G-protein coupled receptors, with seven transmembrane domains connected by intracellular and extracellular loops. While experimental crystal structures for OR8U1 are not yet available, AlphaFold-predicted structures provide insight into its three-dimensional arrangement .

Key functional regions include:

  • Transmembrane Domains: These hydrophobic regions span the cell membrane and form the core structure of the receptor. The transmembrane domains create a binding pocket for odorant molecules.

  • Extracellular Loops: These regions, particularly the second extracellular loop (ECL2), contribute to ligand selectivity by forming part of the entrance to the binding pocket.

  • Intracellular Loops: These regions interact with G-proteins and other signaling molecules, transmitting the signal initiated by odorant binding.

  • N-terminal Domain: This region may contribute to receptor trafficking and folding.

  • C-terminal Domain: This region often contains phosphorylation sites important for receptor desensitization and internalization.

Structure-function studies of olfactory receptors suggest that variation in the transmembrane domains, particularly TM3, TM5, and TM6, significantly influences odorant selectivity. Comparative analysis with other olfactory receptors can provide insights into the structural basis for OR8U1's specific recognition properties.

What approaches are used to identify potential ligands for OR8U1?

Identifying ligands for olfactory receptors like OR8U1 involves several complementary approaches:

  • High-throughput Screening: Testing large libraries of odorant molecules against cells expressing OR8U1 can identify compounds that activate the receptor. These screens typically employ functional assays such as calcium imaging or cAMP measurement .

  • Structure-based Virtual Screening: Computational methods using homology models or AlphaFold-predicted structures of OR8U1 can predict potential ligands through molecular docking simulations .

  • Fragment-based Approaches: Testing structurally diverse molecular fragments can identify chemical moieties that contribute to receptor activation, guiding the design of more potent and selective ligands.

  • Chemoinformatic Analysis: Statistical approaches analyzing the relationship between molecular features and receptor activation across multiple odorants can predict new ligands based on structural similarities.

  • Concentration-Response Analysis: Examining OR8U1 responses across multiple ligand concentrations provides critical information about receptor sensitivity and efficacy, as olfactory perception is highly concentration-dependent .

The M2OR database exemplifies efforts to systematically catalog olfactory receptor-odorant interactions, including information about bioassay conditions, stereochemistry, and concentration effects . Such resources can inform the design of targeted screens for OR8U1 ligands.

What challenges exist in producing recombinant OR8U1 protein?

Production of recombinant olfactory receptors presents several technical challenges due to their hydrophobic nature and structural complexity:

  • Expression Systems: While cell-free systems have been successfully used for other olfactory receptors like OR5AL1 , expression in bacterial, insect, or mammalian cells may require optimization for OR8U1. Each system offers different advantages for protein folding, post-translational modifications, and yield.

  • Solubilization and Stability: As membrane proteins, olfactory receptors require careful selection of detergents or lipid environments to maintain their native conformation during purification.

  • Protein Verification: Confirming the proper folding and functionality of recombinant OR8U1 requires specialized assays, which may include ligand binding studies or conformational analysis.

  • Yield Optimization: Typical expression levels for GPCRs are low, necessitating strategies such as fusion tags, codon optimization, or chaperone co-expression to enhance yields.

  • Purification Challenges: Achieving high purity (≥85%) as seen with other olfactory receptors requires optimized chromatography protocols to separate the target protein from contaminants while maintaining structural integrity.

A systematic approach testing multiple expression constructs, host systems, and purification conditions is typically required to establish a robust protocol for recombinant OR8U1 production.

How can OR8U1-mediated signaling be measured in experimental settings?

Measuring OR8U1-mediated signaling requires assays that can detect the downstream consequences of receptor activation. Several methodological approaches are available:

  • Calcium Imaging: Using calcium-sensitive fluorescent dyes (e.g., Fura-2, Fluo-4) or genetically encoded calcium indicators (e.g., GCaMP), researchers can visualize and quantify the calcium influx that occurs following receptor activation. This technique offers high spatial and temporal resolution, making it suitable for both population and single-cell analyses .

  • BRET/FRET Assays: Bioluminescence or Fluorescence Resonance Energy Transfer assays can monitor protein-protein interactions in the signaling cascade, such as receptor-G protein coupling or arrestin recruitment, providing insights into signaling dynamics.

  • cAMP Accumulation Assays: Using either radioimmunoassay, enzyme immunoassay, or FRET-based sensors, researchers can quantify the production of cAMP, a key second messenger in the olfactory signaling pathway.

  • Patch-Clamp Electrophysiology: This technique can directly measure ion channel activity downstream of receptor activation in native olfactory neurons or heterologous systems expressing OR8U1.

  • Luciferase Reporter Assays: Systems incorporating luciferase genes under the control of cAMP-responsive elements can amplify signals for better detection of receptor responses, particularly useful for high-throughput screening.

When designing signaling assays, important considerations include:

ConsiderationDescriptionImpact on Experimental Design
Signal-to-noise ratioBackground activity in the absence of ligandsRequires appropriate controls and statistical analysis
Temporal resolutionSpeed of data acquisition relative to signaling kineticsDetermines suitability for measuring rapid, transient signals
SensitivityMinimum detectable change in signalingAffects ability to detect responses to low-efficacy ligands
ThroughputNumber of conditions that can be tested simultaneouslyDetermines suitability for screening applications
Physiological relevanceHow closely the assay mimics in vivo conditionsAffects translatability of findings to biological function

What molecular biology techniques are useful for studying OR8U1 gene expression?

Understanding OR8U1 gene expression patterns requires a combination of molecular biology techniques:

  • Quantitative PCR (qPCR): This technique allows precise quantification of OR8U1 mRNA levels across different tissues or experimental conditions. Careful primer design is essential to ensure specificity given the sequence similarity among olfactory receptor genes.

  • RNA Sequencing (RNA-Seq): This high-throughput approach provides comprehensive transcriptome analysis, enabling detection of OR8U1 expression along with other genes. Single-cell RNA-Seq is particularly valuable for characterizing the heterogeneity of olfactory sensory neurons.

  • In Situ Hybridization: This technique visualizes OR8U1 mRNA in tissue sections, providing spatial information about gene expression. RNAscope and other advanced in situ methods offer improved sensitivity for detecting low-abundance transcripts like olfactory receptors.

  • Reporter Gene Assays: Constructs containing the OR8U1 promoter driving expression of reporter genes (e.g., GFP, lacZ) can be used to study transcriptional regulation in vitro or in transgenic models.

  • Chromatin Immunoprecipitation (ChIP): This technique identifies transcription factors and epigenetic modifications associated with the OR8U1 promoter, providing insights into regulatory mechanisms.

When analyzing OR8U1 expression data, it's important to consider the "one neuron-one receptor" rule that characterizes olfactory sensory neurons, which may result in apparent low expression levels in bulk tissue samples despite significant expression in specific neuronal subpopulations.

How can computational methods aid in understanding OR8U1 function?

Computational approaches offer powerful tools for investigating OR8U1 structure, function, and evolution:

  • Homology Modeling and Molecular Dynamics: These techniques can generate and refine structural models of OR8U1, complementing experimental structural data such as AlphaFold predictions . Molecular dynamics simulations can provide insights into ligand binding mechanisms and conformational changes associated with activation.

  • Ligand Docking and Virtual Screening: These methods predict binding modes and affinities of potential odorants to OR8U1, prioritizing compounds for experimental testing. Integration with machine learning approaches can improve prediction accuracy.

  • Sequence Analysis and Phylogenetics: Comparative analysis of OR8U1 with other olfactory receptors can identify conserved functional motifs and evolutionary relationships. Positive selection analysis can highlight residues potentially involved in ligand specificity.

  • Systems Biology Approaches: Network analysis integrating olfactory receptor activation patterns, including OR8U1, with perceptual data can help decode the combinatorial olfactory code .

  • Bioinformatic Database Integration: Tools that integrate data from resources like M2OR , COSMIC , and protein structure databases enable comprehensive analysis of OR8U1 in the context of the broader olfactory system.

When applying computational methods to OR8U1 research, validation of predictions through experimental approaches remains essential. The integration of computational and experimental data typically provides the most robust insights into receptor function.

What considerations are important when designing mutagenesis studies for OR8U1?

Mutagenesis studies are valuable for identifying key residues involved in OR8U1 function. Important considerations include:

  • Selection of Target Residues: Priority should be given to:

    • Residues in predicted transmembrane domains, particularly those facing the putative binding pocket

    • Residues that differ between OR8U1 and closely related receptors with distinct ligand preferences

    • Conserved motifs known to be important in GPCR function

    • Residues with reported mutations in databases like COSMIC

  • Types of Mutations to Introduce:

    • Conservative substitutions (preserving physicochemical properties) to probe subtle structural requirements

    • Non-conservative substitutions to test the importance of specific chemical interactions

    • Alanine scanning to systematically assess the contribution of side chains

    • Reciprocal mutations between related receptors to test the transfer of functional properties

  • Functional Validation:

    • Comprehensive testing of mutant receptors should include:

      • Surface expression analysis to confirm proper folding and trafficking

      • Dose-response studies with multiple ligands to assess changes in potency and efficacy

      • Binding assays to distinguish effects on ligand binding versus signal transduction

  • Data Analysis and Interpretation:

    • Statistical methods for comparing wild-type and mutant responses

    • Structural mapping of functional data to generate mechanistic hypotheses

    • Integration with computational models to refine understanding of structure-function relationships

The results of mutagenesis studies can provide insights into the molecular determinants of OR8U1 ligand specificity and activation mechanisms, contributing to a broader understanding of olfactory receptor function.

How can the M2OR database be leveraged for OR8U1 research?

The Molecule to Olfactory Receptor (M2OR) database represents a valuable resource for researchers studying OR8U1 and other olfactory receptors. Effective utilization of this database involves:

  • Exploring Known Interactions: The M2OR database contains 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs . Researchers can query this database to identify any documented interactions involving OR8U1 or structurally similar receptors.

  • Analyzing Structure-Activity Relationships: By examining the chemical structures of molecules that activate receptors similar to OR8U1, researchers can develop hypotheses about potential OR8U1 ligands.

  • Experimental Design Guidance: The database includes detailed information about:

    • Bioassay methodologies used in previous studies

    • Screening concentrations and EC50 values, which are critical for experimental planning

    • Stereochemistry of test compounds, which can significantly impact receptor responses

  • Comparative Analysis: The database enables systematic comparison of OR8U1 with other receptors, potentially revealing:

    • Receptors with overlapping ligand preferences

    • Chemical features that determine receptor selectivity

    • Concentration-dependent effects on receptor activation patterns

  • Data Contribution: Researchers generating new data on OR8U1-ligand interactions can contribute to this community resource, enhancing its value for future studies.

The M2OR database's emphasis on including both responsive and non-responsive OR-molecule pairs provides a more complete picture of receptor selectivity than resources focused only on positive interactions . This comprehensive approach is particularly valuable for understanding the specificity of receptors like OR8U1 within the broader context of olfactory coding.

What are the primary research gaps in OR8U1 knowledge?

Despite advances in olfactory receptor research, significant knowledge gaps remain for OR8U1:

  • Ligand Specificity Profile: The complete repertoire of odorants that activate OR8U1 remains incompletely characterized, limiting our understanding of its role in olfactory perception.

  • Structure-Function Relationships: While computational models provide structural insights, experimental validation of key residues involved in ligand binding and receptor activation is needed.

  • Regulatory Mechanisms: The factors controlling OR8U1 expression in olfactory sensory neurons, including transcriptional regulators and epigenetic mechanisms, are not fully understood.

  • Functional Significance: The specific contribution of OR8U1 to odor perception and discrimination in humans requires further investigation, particularly in the context of the combinatorial code.

  • Interindividual Variation: The impact of genetic polymorphisms in OR8U1 on olfactory perception represents an important area for future research, potentially connecting molecular mechanisms to perceptual differences.

Addressing these gaps will require integrated approaches combining molecular, cellular, and behavioral techniques, along with computational methods and database resources like M2OR .

How might advances in OR8U1 research impact broader scientific fields?

Research on OR8U1 has implications extending beyond olfaction:

  • GPCR Structure and Function: Insights from OR8U1 studies may inform our understanding of G-protein coupled receptors more broadly, contributing to drug discovery for this important receptor family.

  • Sensory Neuroscience: Understanding how OR8U1 contributes to the combinatorial code of olfaction advances our knowledge of sensory processing principles.

  • Evolutionary Biology: Comparative studies of OR8U1 across species can illuminate the evolution of sensory systems and environmental adaptations.

  • Biomedical Applications: Knowledge of OR8U1 function may contribute to understanding disorders of olfaction and the development of diagnostic tools or therapeutic approaches.

  • Synthetic Biology: Engineering systems incorporating OR8U1 could lead to novel biosensors for environmental monitoring or diagnostic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.