Recombinant Human Olfactory receptor 8U8 (OR8U8)

What is the basic structure and cellular localization of OR8U8?

OR8U8 is a full-length human olfactory receptor protein consisting of 319 amino acids. The amino acid sequence begins with MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRAD and continues through to the C-terminal sequence ending with RNHAFIFLKLRK . Like other olfactory receptors, OR8U8 is primarily localized to the plasma membrane . This localization is critical for its function, as it needs to interact with odorant molecules in the environment. The receptor contains the characteristic seven-transmembrane domain structure common to G-protein coupled receptors (GPCRs), with extracellular N-terminus and intracellular C-terminus. The transmembrane domains form a pocket where odorant binding occurs, triggering conformational changes that activate downstream signaling pathways.

What expression systems are effective for producing recombinant OR8U8?

Recombinant OR8U8 can be successfully expressed in E. coli expression systems . The protein can be produced with an N-terminal His-tag to facilitate purification. The recombinant protein preparation typically results in a product with greater than 90% purity as determined by SDS-PAGE . When expressing OR8U8, it's important to note that membrane proteins like olfactory receptors can often form inclusion bodies in bacterial systems, requiring optimization of expression conditions. Alternative eukaryotic expression systems such as yeast, insect cells, or mammalian cells might provide better folding environments for functional studies, though these weren't specifically mentioned in the provided search results for OR8U8.

How should recombinant OR8U8 protein be stored and handled for optimal stability?

Recombinant OR8U8 protein is typically supplied as a lyophilized powder . For storage, the following guidelines are recommended:

• Store at -20°C/-80°C upon receipt

• Aliquoting is necessary for multiple use to prevent protein degradation

• Avoid repeated freeze-thaw cycles as they can compromise protein integrity

• Working aliquots can be stored at 4°C for up to one week

For reconstitution:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C, with 50% being the standard recommendation

The protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the primary applications for recombinant OR8U8 in basic research?

Recombinant OR8U8 can be used in a variety of basic research applications:

• SDS-PAGE analysis to study protein characteristics and quality

• Structural studies to understand the binding pocket architecture

• Ligand binding assays to identify potential odorants that activate this receptor

• Antibody generation for immunohistochemistry studies

• In vitro signaling assays to characterize receptor function

Additionally, OR8U8 can be used in broader studies investigating olfactory system function, particularly in understanding how individual receptors contribute to odor detection thresholds . The recombinant protein serves as a valuable tool for researchers aiming to understand the molecular basis of olfaction and the specific role of OR8U8 in this sensory system.

How does copy-number variation of OR8U8 affect its functional properties and olfactory perception?

Copy-number variation (CNV) of olfactory receptor genes, including OR8U8, represents a significant source of genetic diversity that may impact olfactory perception among individuals . Research indicates that OR genes are enriched in copy-number variable regions of the genome, with this enrichment likely due to their preponderance in segmentally duplicated regions rather than positive selection .

The functional consequences of OR8U8 CNVs may include:

• Altered odor detection thresholds for specific odorants

• Variable olfactory discrimination abilities

• Potential compensatory mechanisms within the olfactory system

Studies of olfactory receptors suggest that odor detection thresholds are determined by the most sensitive receptor for a given odorant, with no contribution from other highly sensitive receptors . If OR8U8 is the threshold-determining receptor for certain odorants, CNV affecting its expression could directly impact an individual's ability to detect these compounds at low concentrations.

Methodologically, researchers investigating OR8U8 CNV effects should consider:

• Using multiplex ligation-dependent probe amplification (MLPA) and PCR to accurately assay copy numbers in human populations

• Combining genetic analysis with functional assays such as calcium imaging or electrophysiology

• Conducting psychophysical testing to correlate genetic variation with perceptual differences

• Employing animal models with genetic modifications to determine causative relationships

What experimental approaches are most effective for studying OR8U8 ligand interactions and activation mechanisms?

Studying the ligand interactions and activation mechanisms of OR8U8 requires sophisticated experimental approaches that address the challenges of working with olfactory receptors. Several methodologies can be employed:

• Heterologous Expression Systems:

  • Expression in HEK293 cells or other mammalian cell lines with appropriate chaperones

  • Incorporation into nanodiscs or liposomes to maintain native-like membrane environment

  • Use of specialized vectors that enhance surface expression of olfactory receptors

• Ligand Identification:

  • High-throughput screening of odorant libraries using calcium imaging

  • Measuring cAMP production via BRET or FRET-based assays

  • Utilizing the DREAM assay (Deorphanization of Receptors based on Expression Alterations in Messenger RNA levels), which measures the downregulation of receptor mRNA after odorant exposure

• Structural Analysis:

  • Computational modeling based on known GPCR structures

  • Mutagenesis studies to identify key binding residues

  • Potential application of cryo-EM for structural determination

• Functional Validation:

  • In vivo studies using gene editing techniques

  • Electrophysiological recordings from cells expressing OR8U8

  • Behavioral assays to correlate receptor function with perception

When conducting these experiments, odorants should be carefully diluted and delivered using a flow dilution olfactometer to ensure precise concentration control . For in vitro studies, disposable glass vials should be used to prevent cross-contamination, and odor trials should be interleaved with clean air trials to identify potential contamination issues .

How do post-translational modifications affect OR8U8 trafficking and function?

Post-translational modifications (PTMs) play crucial roles in the proper trafficking, localization, and function of olfactory receptors including OR8U8. While the search results don't specifically address PTMs for OR8U8, research on olfactory receptors generally indicates several important modifications:

• N-linked Glycosylation:

  • Occurs at conserved asparagine residues in the N-terminal region and extracellular loops

  • Critical for proper folding and trafficking to the plasma membrane

  • May affect ligand recognition and binding affinity

• Palmitoylation:

  • Cysteine residues in the C-terminal region are often palmitoylated

  • Enhances association with lipid rafts in the plasma membrane

  • Contributes to signaling complex formation with G proteins

• Phosphorylation:

  • Occurs primarily on serine and threonine residues in intracellular loops and C-terminus

  • Regulates receptor desensitization and internalization

  • May be mediated by GRKs (G protein-coupled receptor kinases)

Research methodology to study PTMs of OR8U8 should include:

• Mass spectrometry to identify specific modification sites

• Site-directed mutagenesis to assess the functional importance of modified residues

• Live-cell imaging to track trafficking of fluorescently tagged constructs

• Co-immunoprecipitation studies to identify interacting proteins involved in PTM processes

Understanding these modifications is critical as they may explain differences in receptor functionality between heterologous expression systems and native olfactory sensory neurons, and could provide insights into the variability of olfactory perception among individuals.

What are the optimal conditions for functional reconstitution of OR8U8 for in vitro binding studies?

Functional reconstitution of OR8U8 for in vitro binding studies presents significant challenges due to the hydrophobic nature of this membrane protein. Based on general methodologies for olfactory receptors, the following approaches can be recommended:

• Detergent Selection and Solubilization:

  • Mild detergents such as DDM (n-dodecyl-β-D-maltoside), DMNG (decyl maltose neopentyl glycol), or CHAPS are preferred

  • Detergent concentration should be optimized to maintain protein stability while effectively solubilizing membranes

  • Addition of cholesterol or other lipids may enhance stability

• Membrane Mimetic Systems:

  • Nanodiscs composed of phospholipids and membrane scaffold proteins

  • Liposomes with optimized lipid composition mimicking olfactory cilia membranes

  • Bicelles or amphipols as alternative membrane mimetics

• Buffer Optimization:

  • pH range 7.4-8.0 appears suitable based on storage buffer information

  • Inclusion of glycerol (5-10%) to enhance stability

  • Addition of reducing agents such as DTT or TCEP to prevent disulfide bond formation

  • Presence of protease inhibitors to prevent degradation

• Binding Assay Development:

  • Fluorescence-based assays using environmentally sensitive probes

  • Surface plasmon resonance (SPR) with immobilized receptor

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Microscale thermophoresis (MST) for measuring interactions in solution

For successful reconstitution, the recombinant OR8U8 should be carefully extracted from expression systems using optimized protocols that maintain the native conformation of the protein. The reconstituted protein should be validated for proper folding using circular dichroism spectroscopy and for functionality using ligand binding assays before proceeding with detailed binding studies.

How does OR8U8 contribute to the broader olfactory receptor network and odor coding?

OR8U8, like other olfactory receptors, functions within a complex network that collectively enables odor perception. Understanding its specific contribution requires consideration of several aspects:

Methodologically, researchers investigating OR8U8's contribution to odor coding should consider:

• Optical imaging of glomerular responses using calcium or voltage indicators

• Single-cell RNA sequencing to identify co-expression patterns with other genes

• Computational modeling of receptor network dynamics

• Behavioral assays with genetic manipulations to assess the impact of OR8U8 on specific odor perceptions