Recombinant Human Olfactory receptor 8U9 (OR8U9)

Shipped with Ice Packs
In Stock

Description

Introduction to OR8U9

Olfactory Receptor 8U9 (OR8U9) is a class II odorant receptor belonging to the G protein-coupled receptor (GPCR) family, specifically within the tetrapod-specific odorant receptor subfamily . As part of the largest mammalian gene family, olfactory receptors mediate odorant detection and signal transduction in olfactory sensory neurons . Recombinant Human OR8U9 refers to the genetically engineered form of this receptor, produced for experimental studies to elucidate its structure, function, and potential therapeutic applications .

Genomic Context

  • Gene Symbol: OR8U9 (HGNC: 29166)

  • Chromosomal Location: 11q12.1

  • Organism: Homo sapiens (Human)

Protein Features

PropertyDetail
UniProt IDP0C7N5
Protein ClassClass A GPCR (Rhodopsin-like family)
Molecular Weight~35 kDa (predicted)
Structure7-transmembrane domain protein
Physiological LigandsNot yet identified

Expression Systems and Purification

ParameterDetails
Host SystemsBaculovirus, Yeast, E. coli, Mammalian cells
Purity>85% (SDS-PAGE verified)
TaggingVaries by product (e.g., AviTag, His-Tag)
StorageLyophilized: -80°C (12 months); Liquid: -80°C (6 months)

Antibody Development

The OR8U1/OR8U8/OR8U9 Antibody (PACO03654) is a polyclonal rabbit antibody validated for:

  • Applications: Immunofluorescence (1:200–1:1000 dilution), ELISA

  • Immunogen: Synthetic peptide from the internal region of OR8U9

  • Cross-Reactivity: Human-specific

ELISA Kits

Kit FeatureDetail
Detection Range0.156–10 ng/ml
Sample TypesTissue homogenates, cell lysates
SensitivityColorimetric detection with a 6-month validity

Olfactory and Non-Olfactory Functions

  • Olfaction: Detects odorants through cAMP-mediated signaling pathways .

  • Ectopic Expression: Found in non-olfactory tissues (e.g., blood cells, prostate) :

    • Immune Modulation: OR2AT4 and OR51B5 regulate myeloid leukemia cell proliferation and apoptosis .

    • Neurological Impact: OR4M1 activation reduces tau phosphorylation in neurons .

Disease Associations

  • Cancer: Overexpression in prostate cancer correlates with tumor invasiveness .

  • Neurodegeneration: Dysregulation linked to tauopathies and Alzheimer’s disease .

Signaling Pathways

PathwayMechanismOutcome
Canonical (Olfactory)cAMP ↑ → CNG channel activation → Ca²⁺ influx Neuronal depolarization
Non-CanonicalGβγ-mediated PI3K/AKT activation Cell migration, apoptosis regulation

Challenges and Future Directions

  • Ligand Identification: No physiological ligands confirmed; in silico screens using POM (Primary Odor Map) may aid discovery .

  • Therapeutic Potential: Targeting OR8U9 in cancer or neurodegeneration requires resolving its 3D structure .

  • Technical Limitations: Low native expression levels necessitate recombinant systems for study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your requests as best as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize the development of your specified tag.
Synonyms
OR8U9; Olfactory receptor 8U9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR8U9
Target Protein Sequence
MTQINCTQVTEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRTDEKLNTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNSISFNACAAQLGCFLAFMTAECLLLASMAY DRYVAICNPLMYMVVMSPGICIQLVAAPHSYSILVALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA LKKIIINKN
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 29166

KEGG: hsa:504190

UniGene: Hs.553618

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of OR8U9?

OR8U9 (Olfactory Receptor, Family 8, Subfamily U, Member 9) is a human olfactory receptor classified as a class II olfactory receptor. The receptor consists of 309 amino acids with a molecular weight of approximately 35.1 kDa . The protein sequence begins with MTQINCTQVT and contains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors (GPCRs) . OR8U9 is encoded by the OR8U9 gene in humans and has the UniProt identifier P0C7N5 . The receptor functions primarily as an odorant receptor, participating in the transduction of olfactory signals upon activation by specific odorant molecules .

Structurally, OR8U9 contains highly conserved C-terminal motifs that are characteristic of class II olfactory receptors, which differentiate it from class I receptors. These motifs play crucial roles in determining the receptor's cell surface expression and signaling capabilities .

What expression systems are effective for producing recombinant OR8U9?

Recombinant OR8U9 can be effectively produced in mammalian expression systems, with HEK-293 cells being a particularly suitable host . When expressing OR8U9 for research purposes, adding a purification tag such as a His-tag facilitates downstream purification processes . The key challenge with expressing olfactory receptors, including OR8U9, is achieving sufficient cell surface expression, as these receptors are often poorly expressed on the surface of heterologous cells .

For improved expression efficiency, researchers should consider:

  • Optimizing the expression vector with strong promoters

  • Using chaperone proteins to assist with proper folding

  • Implementing the TAR-Tat system, which significantly increases transcription efficiency through a positive feedback mechanism

  • Cell-free protein synthesis systems for applications requiring rapid production

Purification of recombinant OR8U9 typically involves affinity chromatography (utilizing the His-tag), followed by analytical SEC (HPLC) to confirm purity levels, which should ideally exceed 70-80% as determined by SDS-PAGE and Western blot analysis .

What methodologies are most effective for studying OR8U9 cell surface expression?

Studying OR8U9 cell surface expression requires sophisticated methodological approaches to overcome the inherent challenges of olfactory receptor trafficking. Effective methodologies include:

  • Fluorescence-based approaches:

    • Tagging OR8U9 with fluorescent proteins (e.g., GFP) at its N-terminus while maintaining the integrity of the C-terminal motifs that regulate trafficking

    • Using immunofluorescence with antibodies targeting extracellular epitopes or N-terminal tags

    • Employing flow cytometry for quantitative assessment of surface expression levels

  • Biochemical approaches:

    • Cell surface biotinylation followed by streptavidin pull-down and Western blot analysis

    • Enzyme-linked immunosorbent assays (ELISA) using antibodies against extracellular domains

  • Enhanced expression systems:

    • Implementing the TAR-Tat system, which has been demonstrated to increase transcriptional efficiency and thereby improve the cell surface expression of human olfactory receptors through a positive feedback mechanism

    • Co-expression with receptor transporters or chaperones that facilitate proper folding and trafficking

  • Mutation analysis:

    • Systematic mutation of C-terminal motifs to identify specific amino acids that influence surface expression

    • Creation of chimeric receptors by swapping C-terminal domains between well-expressed and poorly-expressed olfactory receptors

When designing these experiments, researchers should consider both the quantitative (amount of receptor at the cell surface) and qualitative (proper folding and functionality) aspects of expression, as surface expression alone does not guarantee functional activity.

How do C-terminal motifs affect OR8U9 functionality and signaling?

The C-terminal motifs in OR8U9, like other class II olfactory receptors, play crucial roles in regulating both cell surface expression and signal transduction. Research methodologies to investigate these effects include:

  • Truncation experiments: Systematic deletion of C-terminal amino acids to determine the minimal required sequence for proper functioning .

  • Site-directed mutagenesis: Targeting specific amino acids within conserved motifs to assess their individual contributions to:

    • Membrane targeting and retention

    • G protein coupling efficiency

    • cAMP signaling amplitude and kinetics

    • Receptor internalization and recycling

  • Functional readouts:

    • Real-time cAMP measurements using FRET-based biosensors or GloSensor technology

    • Calcium imaging in cells co-expressing Gα15/16 proteins

    • Electrophysiological recordings in expression systems

Research has demonstrated that mutations in C-terminal motifs can have differential effects on surface expression versus signaling capability, indicating that these domains serve multiple functions in receptor biology . For instance, certain mutations may enhance surface expression while simultaneously reducing signaling efficiency, or vice versa, suggesting distinct molecular mechanisms for these processes.

The number of these conserved C-terminal motifs has increased during evolution, highlighting their functional importance and suggesting potential species-specific differences in OR8U9 regulation and function that should be considered when selecting model systems .

What experimental approaches can optimize functional characterization of OR8U9?

Functional characterization of OR8U9 requires overcoming several technical challenges inherent to olfactory receptors. Optimal experimental approaches include:

  • Enhanced expression systems:

    • Implementation of the TAR-Tat system, which increases transcription efficiency through positive feedback mechanisms, resulting in significant improvements in both cell surface expression and functional responses of olfactory receptors

    • Co-expression with receptor transport proteins (RTPs) and other accessory factors

  • Signal amplification strategies:

    • Co-expression with the olfactory G protein alpha subunit (GNAL/Gαolf) to enhance coupling efficiency

    • Utilization of highly sensitive cAMP detection methods, including bioluminescence-based assays

  • Ligand screening approaches:

    • High-throughput screening using libraries of odorant compounds

    • Computational prediction of ligand-receptor interactions based on structural modeling

    • Dose-response measurements to determine EC50/IC50 values for identified ligands

  • Functional readout optimization:

    • Development of stable cell lines with inducible OR8U9 expression

    • Implementation of automated imaging platforms for detecting receptor activation

    • Integration of electrophysiological measurements with biochemical assays

Recent research has demonstrated that increasing transcriptional levels through systems like TAR-Tat can reveal previously undetectable relationships between olfactory receptors and their odorants. This approach has successfully identified novel odorant-receptor pairs and even characterized some odorants as inverse agonists rather than traditional agonists .

What methods are available for analyzing structure-function relationships in OR8U9?

Investigating structure-function relationships in OR8U9 requires a multidisciplinary approach combining computational, biochemical, and functional methodologies:

  • Computational methods:

    • Homology modeling based on available GPCR crystal structures

    • Molecular dynamics simulations to predict ligand binding pockets and protein dynamics

    • Analysis of AlphaFold-predicted structures, which are now available for OR8U9

  • Mutagenesis approaches:

    • Alanine-scanning mutagenesis of transmembrane domains to identify critical residues

    • Creation of chimeric receptors with other olfactory receptors to map functional domains

    • Site-directed mutagenesis guided by evolutionary conservation analysis

  • Biochemical characterization:

    • Protein fragmentation and epitope mapping

    • Cysteine accessibility studies to probe transmembrane topology

    • Cross-linking experiments to identify proximity relationships between domains

  • Ligand interaction studies:

    • Photo-affinity labeling with modified odorants

    • Competition binding assays to define the binding pocket

    • Structure-activity relationship studies with systematically modified odorants

A key focus should be on the relationship between the C-terminal motifs and other functional domains of the receptor, as research has demonstrated that these motifs significantly influence both expression and signaling properties of olfactory receptors .

OR8U9 Protein Characteristics

CharacteristicValueReference
UniProt IDP0C7N5
Protein Length309 amino acids
Molecular Weight35.1 kDa
Receptor ClassClass II olfactory receptor
Gene NameOR8U9
FunctionOdorant receptor
Expression SystemHEK-293 cells
Purification TagHis tag

Methodological Approaches for OR8U9 Research

Research ObjectiveRecommended MethodsKey ConsiderationsReference
Surface Expression EnhancementTAR-Tat system implementationIncreases transcription efficiency through positive feedback
Functional Activity AssessmentcAMP measurement, calcium imagingCo-expression with olfactory G proteins recommended
Structural AnalysisC-terminal motif mutation analysisFocus on helix 8 region for expression and signaling effects
Ligand DiscoveryHigh-throughput screening with TAR-Tat systemCan identify previously undetectable odorant-receptor relationships
Protein ProductionMammalian cell expression (HEK-293)Target >70-80% purity by SDS-PAGE and Western Blot

Impact of C-Terminal Motifs on Receptor Function

Research findings demonstrate that C-terminal motifs in olfactory receptors like OR8U9 have evolved to regulate both surface expression and signaling capabilities. The number of these motifs has increased during evolution, suggesting progressive refinement of receptor regulation mechanisms . Experimental data shows that:

  • Single amino acid changes in these motifs can have differential effects on:

    • Cell surface trafficking

    • Receptor stability

    • G protein coupling efficiency

    • cAMP signal amplitude and duration

  • Class II olfactory receptors (including OR8U9) have distinct C-terminal motif patterns compared to class I receptors, contributing to their unique functional properties .

  • These motifs often overlap with helix 8 of the receptor structure, a region known to be critical for GPCR function across many receptor families .

What emerging technologies could advance OR8U9 research?

Emerging technologies with potential to transform OR8U9 research include:

  • Single-cell analysis techniques for studying receptor expression variability and signaling dynamics in individual cells

  • CRISPR-Cas9 genome editing for creating precise modifications to study endogenous OR8U9 regulation in relevant cell types

  • Advanced imaging techniques including super-resolution microscopy to visualize receptor trafficking and organization in the membrane

  • Cryo-electron microscopy for determining high-resolution structures of the receptor in different conformational states

  • Computational approaches integrating artificial intelligence for predicting ligand-receptor interactions based on structural data

  • Organoid models of human olfactory epithelium for studying OR8U9 in a more physiologically relevant context

These technologies, combined with established methodologies and systems like TAR-Tat for enhancing expression, have the potential to overcome long-standing challenges in olfactory receptor research and provide new insights into OR8U9 function .

How can OR8U9 research contribute to understanding olfactory coding?

Deciphering the role of OR8U9 in olfactory coding requires systematic investigation of its response profile and integration into the broader olfactory receptor repertoire. Key research avenues include:

  • Comprehensive deorphanization studies to identify the full spectrum of odorants that activate or inhibit OR8U9

  • Analysis of OR8U9 expression patterns in human olfactory epithelium using single-cell RNA sequencing approaches

  • Investigation of signal integration by comparing OR8U9 responses with those of related olfactory receptors when exposed to complex odorant mixtures

  • Exploration of potential species-specific differences in OR8U9 function to understand evolutionary adaptations in olfactory perception

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.