Recombinant Human Olfactory receptor 9A2 (OR9A2)

Shipped with Ice Packs
In Stock

Description

Introduction to OR9A2

OR9A2 is encoded by the OR9A2 gene located on human chromosome 7 . It belongs to the olfactory receptor family, the largest GPCR family in the human genome, with 339 intact OR genes identified . Recombinant OR9A2 is produced in heterologous systems (e.g., HEK293 cells) for functional studies, enabling researchers to investigate its ligand specificity and signaling mechanisms .

Genomic and Functional Context

  • Chromosomal Location: Chromosome 7

  • Subfamily: Family 9, subfamily A

  • Ligand Specificity: Unknown for OR9A2, but related subfamilies detect aliphatic or thiol-containing compounds .

  • Evolution: OR9A2 likely arose through gene duplication, a common mechanism in olfactory receptor diversification .

Recombinant Expression and Purification

Recombinant OR9A2 is challenging to produce due to GPCR complexity, but advances include:

  • Expression Systems:

    • HEK293 Cells: Stable tetracycline-inducible lines enable controlled production .

    • Xenopus Oocytes: Used for electrophysiological studies of related ORs .

  • Purification Methods:

    • Immunoaffinity chromatography (anti-FLAG/Rho1D4 tags)

    • Gel filtration to isolate monomeric/dimeric forms

Table 2: Expression Metrics for Olfactory Receptors (Representative Data)

ReceptorYield (mg/L)Purity (%)Functional Assay
hOR1A11.6–1.1>90cAMP signaling, Ca²⁺ imaging
OR17-40N/AN/ACa²⁺ imaging, Xenopus oocytes

Functional Insights from Related Receptors

While OR9A2’s ligands are uncharacterized, studies on homologous receptors reveal:

  • Combinatorial Coding: Odors activate multiple receptors, and single receptors respond to structurally related molecules .

  • Ligand Affinity: Micromolar-range binding observed in detergent-solubilized ORs (e.g., hOR1A1 binds dihydrojasmone) .

  • Assay Sensitivity: Calcium imaging and cAMP assays detect receptor activation .

Research Applications

  • Odorant Screening: Identification of agonists/antagonists via high-throughput assays .

  • Biosensor Development: Engineered ORs for detecting volatile compounds .

  • Disease Links: Olfactory dysfunction correlates with neurodegenerative diseases, motivating OR studies .

Challenges and Future Directions

  • Deorphanization: OR9A2 remains an "orphan" receptor with no confirmed ligands .

  • Structural Studies: No resolved 3D structure exists for OR9A2; cryo-EM or crystallography efforts are needed .

  • Database Gaps: M2OR catalogs 75,050 OR-molecule pairs but lacks OR9A2 entries .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
OR9A2; Olfactory receptor 9A2; Olfactory receptor OR7-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR9A2
Target Protein Sequence
MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCVDKRLQSPMYF FLSHLSTLEILVTTIIVPMMLWGLLFLGCRQYLSLHVSLNFSCGTMEFALLGVMAVDRYV AVCNPLRYNIIMNSSTCIWVVIVSWVFGFLSEIWPIYATFQFTFRKSNSLDHFYCDRGQL LKLSCDNTLLTEFILFLMAVFILIGSLIPTIVSYTYIISTILKIPSASGRRKAFSTFASH FTCVVIGYGSCLFLYVKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDG MKRCCQLLKD
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. This publication refers to this gene as 'GPR139'. PMID: 12732197
Database Links

HGNC: 15093

KEGG: hsa:135924

STRING: 9606.ENSP00000316518

UniGene: Hs.553594

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR9A2 and what is its genomic location?

OR9A2 is encoded by the OR9A2 gene located on human chromosome 7. It belongs to the olfactory receptor family, which represents the largest G-protein coupled receptor (GPCR) family in the human genome. There are 339 intact OR genes identified in the human genome, with OR9A2 being one significant member of this extensive family. Olfactory receptors function primarily as odorant detectors, with OR9A2 likely participating in the combinatorial coding mechanism by which humans detect and discriminate between thousands of different odors.

What expression systems are most effective for recombinant OR9A2 production?

Recombinant OR9A2 is most commonly produced in heterologous expression systems, with HEK293 cells being a preferred platform due to their human origin and efficient protein processing machinery. While the search results don't provide specific yield data for OR9A2, comparable olfactory receptors such as hOR1A1 have been successfully expressed with yields of 1.6–1.1 mg/L and purity exceeding 90%. When designing an expression system for OR9A2, researchers should consider:

  • Use of mammalian expression systems to ensure proper post-translational modifications

  • Codon optimization for the expression host

  • Addition of fusion tags (such as FLAG or His) to facilitate purification

  • Temperature optimization during expression (typically 30-37°C)

  • Induction conditions if using inducible promoters

The choice of expression system significantly impacts functional integrity, with mammalian systems generally preserving receptor functionality better than bacterial systems.

What are the known ligands for OR9A2?

  • Combinatorial coding: Multiple receptors respond to a single odorant, and individual receptors respond to multiple structurally related molecules

  • Binding affinities: Typically in the micromolar range for detergent-solubilized ORs

  • Structural determinants: Related receptors often recognize structurally similar odorants

Researchers investigating OR9A2 ligands should consider high-throughput screening approaches that have successfully identified agonists for other olfactory receptors.

What functional assays are available for studying OR9A2 activation?

Several functional assays have been developed to study olfactory receptor activation, though specific protocols for OR9A2 are still emerging. Based on studies with homologous receptors, the following assays can be adapted for OR9A2 research:

Assay TypePrincipleAdvantagesLimitationsReference
cAMP signalingMeasures cAMP production following OR activationHigh sensitivity, quantitativeRequires cell permeabilization
Ca²⁺ imagingDetects intracellular calcium fluxReal-time visualization, single-cell resolutionPotential interference from other calcium pathways
Xenopus oocyte expressionElectrophysiological recordingDirect measurement of channel activityLabor-intensive, specialized equipment needed

When selecting an assay, researchers should consider the specific research question, available equipment, and required sensitivity. For initial ligand screening, calcium imaging offers advantages in throughput, while cAMP assays may provide more quantitative data for detailed pharmacological characterization.

What is the relationship between OR9A2 expression and Parkinson's disease biomarkers?

Recent studies have identified a significant correlation between OR9A2 expression and Parkinson's disease (PD). Analysis of nasal fluid samples has revealed PD-specific alterations in OR9A2 transcript levels, suggesting its potential as a biomarker for distinguishing hyposmia associated with PD from other causes of olfactory dysfunction .

Receiver Operating Characteristic (ROC) curve analysis has demonstrated OR9A2's potential diagnostic value. The transcript levels of OR9A2 show statistically significant differences between PD patients and healthy controls, particularly within the hyposmia subgroup . This correlation is especially noteworthy given that olfactory dysfunction often precedes motor symptoms in PD, potentially offering an early diagnostic opportunity.

When examining OR9A2 as a PD biomarker, researchers should consider:

  • Stratification of subjects by olfactory function (normosmia, hyposmia, anosmia)

  • Correlation with other established PD markers

  • Longitudinal studies to determine if OR9A2 changes precede clinical manifestations

  • Integration with other potential nasal biomarkers like OR10A4 and IFIT1B

How can researchers address experimental design challenges when studying OR9A2?

Experimental design for OR9A2 studies presents several challenges that require careful methodological consideration:

Challenge 1: Variable expression levels
When studying OR9A2 expression, researchers must control for numerous variables that may affect expression levels. Following the general principles of experimental design, investigators should:

  • Clearly define independent variables (e.g., disease state, treatment) and dependent variables (OR9A2 expression levels)

  • Identify and control potential confounding variables (age, sex, medication history)

  • Formulate specific, testable hypotheses about OR9A2 function or expression

Challenge 2: Correlation between variables
When analyzing OR9A2 data, researchers should be aware that correlation between model covariates can lead to ambiguous results and potential misinterpretation . For instance, if OR9A2 expression correlates with both disease state and age, statistical analysis must account for this correlation to avoid attributing age-related effects to disease status or vice versa.

Challenge 3: Sample collection standardization
For nasal fluid samples, standardized collection protocols are essential for reliable OR9A2 quantification. Variations in collection technique, sample processing time, and storage conditions can significantly impact results.

What statistical approaches are most appropriate for analyzing OR9A2 expression data?

The analysis of OR9A2 expression data, particularly in the context of biomarker development, requires robust statistical methodology. Based on published research, the following approaches are recommended:

  • Normalization to reference genes: When analyzing OR9A2 transcript levels, normalization to stable reference genes like GAPDH is essential for reliable quantification . This controls for variations in total RNA amount and reverse transcription efficiency.

  • Non-parametric testing: For comparing OR9A2 expression between groups (e.g., PD vs. control), the nonparametric Mann-Whitney U test has been effectively employed . This approach is particularly appropriate when data do not meet assumptions of normality.

  • ROC curve analysis: To assess OR9A2's potential as a diagnostic biomarker, ROC curve analysis provides valuable information on sensitivity and specificity at various threshold values . The area under the curve (AUC) quantifies diagnostic accuracy.

  • Multivariate analysis: When examining OR9A2 alongside other markers or clinical variables, researchers should employ multivariate analysis, adjusting for age, sex, and other relevant covariates .

  • Transformation of skewed data: For skewed continuous variables, applying log transformations before analysis can address violations of model assumptions .

What are the challenges in purification of functional recombinant OR9A2?

Purification of functional recombinant OR9A2 presents significant technical challenges due to the inherent properties of GPCRs. Researchers should consider the following methodological approaches:

  • Detergent selection: The choice of detergent is critical for maintaining OR9A2 in a functional state. Mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin often provide a good balance between extraction efficiency and functional preservation.

  • Addition of stabilizing agents: Cholesterol hemisuccinate (CHS) and specific lipids can enhance stability during purification.

  • Temperature control: Maintaining low temperatures (4°C) throughout the purification process helps minimize denaturation.

  • Affinity chromatography: Using tags such as His, FLAG, or rho1D4 enables specific purification, with yields and purity comparable to those reported for other olfactory receptors (>90% purity).

  • Validation of functionality: Post-purification assays (e.g., ligand binding, thermostability) are essential to confirm that the purified receptor remains functional.

Researchers should recognize that current methods for OR purification typically result in modest yields (mg/L range), which may necessitate scaling up expression or optimizing purification protocols for specific experimental needs.

How can researchers differentiate between specific OR9A2 responses and general GPCR activation?

Distinguishing specific OR9A2 responses from general GPCR activation requires careful experimental controls:

  • Comparison with inactive mutants: Creating point mutations in key residues of OR9A2 can generate inactive controls that should not respond to specific ligands but may retain general GPCR characteristics.

  • Heterologous expression systems: Using expression systems with minimal endogenous GPCR expression or with knocked-down G-protein signaling can provide cleaner backgrounds for specific OR9A2 response detection.

  • Pharmacological controls: Employing known inhibitors of specific G-protein signaling pathways can help dissect the mechanism of observed responses.

  • Dose-response relationships: Specific receptor-ligand interactions typically exhibit characteristic dose-response curves that differ from non-specific effects.

  • Cross-desensitization experiments: Sequential application of stimuli can reveal whether responses occur through the same receptor mechanism.

By implementing these controls, researchers can increase confidence that observed responses are specifically mediated by OR9A2 rather than through generalized GPCR mechanisms or off-target effects.

What techniques are available for investigating OR9A2's role in olfactory dysfunction?

Investigating OR9A2's role in olfactory dysfunction, particularly in conditions like Parkinson's disease, requires a multi-faceted approach:

How can researchers address data contradictions in OR9A2 studies?

When encountering contradictory results in OR9A2 research, systematic approaches can help resolve discrepancies:

  • Methodology comparison: Carefully examine differences in experimental protocols, including expression systems, assay conditions, and data analysis methods. Small methodological variations can lead to significant outcome differences.

  • Statistical analysis of covariates: As highlighted in neuroimaging research, correlations between model covariates can lead to ambiguous interpretations . Applying appropriate statistical tests that account for these correlations may resolve apparent contradictions.

  • Cell type considerations: OR9A2 function may vary between heterologous expression systems and native olfactory neurons. These differences should be acknowledged when comparing studies.

  • Donor variability: For studies using human samples, genetic and environmental factors may contribute to variable results. Increasing sample sizes and conducting meta-analyses can help identify consistent patterns.

  • Replication studies: Independent replication using standardized protocols is essential for resolving contradictions. Collaborative efforts across laboratories can strengthen confidence in findings.

What are the best practices for validating OR9A2 as a biomarker?

Validating OR9A2 as a biomarker, particularly for conditions like Parkinson's disease, requires a structured approach:

  • Discovery phase: Initial identification of differential OR9A2 expression between disease and control groups should be performed with appropriate sample sizes and statistical rigor .

  • Validation phase: Findings should be confirmed in independent cohorts, ideally from different clinical centers to account for potential site-specific variables.

  • Analytical validation: Methods for OR9A2 detection must demonstrate:

    • Precision (reproducibility)

    • Accuracy (compared to reference standards)

    • Analytical sensitivity (lower limit of detection)

    • Analytical specificity (lack of interference from similar molecules)

  • Clinical validation: Assessment of:

    • Sensitivity and specificity in the target population

    • Positive and negative predictive values

    • ROC curve analysis with clear AUC values

  • Standardization: Development of standard operating procedures for sample collection, processing, and analysis to ensure consistency across laboratories.

  • Comparison with existing biomarkers: Evaluation of OR9A2 alongside established biomarkers to determine whether it provides complementary or redundant information.

What are promising approaches for identifying specific OR9A2 ligands?

The identification of specific OR9A2 ligands represents a significant research opportunity. Researchers should consider these methodological approaches:

  • High-throughput screening: Utilizing calcium imaging or cAMP assays to test libraries of odorants against cells expressing recombinant OR9A2.

  • In silico modeling: Applying computational approaches to predict potential ligands based on the receptor's structure and homology to olfactory receptors with known ligands.

  • Structure-activity relationship studies: Once candidate ligands are identified, systematic modification of their chemical structures can reveal the molecular determinants of OR9A2 activation.

  • Competitive binding assays: Development of labeled reference ligands would enable competitive binding studies to identify and characterize novel ligands.

  • Native tissue verification: Confirming findings from heterologous expression systems in native olfactory tissue to ensure physiological relevance.

How might OR9A2 research contribute to understanding neurodegenerative diseases?

The connection between OR9A2 and neurodegenerative diseases, particularly Parkinson's disease, offers several promising research avenues:

  • Early diagnosis: Given that olfactory dysfunction often precedes motor symptoms in PD, OR9A2 alterations might serve as early biomarkers . Longitudinal studies tracking OR9A2 expression in at-risk populations could reveal its predictive value.

  • Disease mechanism insights: The correlation between OR9A2 expression and PD suggests potential mechanistic links. Investigating whether α-synuclein pathology affects OR9A2 expression or function could provide insights into disease processes .

  • Distinguishing disease subtypes: Different patterns of OR9A2 expression might help differentiate between PD subtypes or identify specific endophenotypes, potentially guiding personalized treatment approaches.

  • Therapeutic target potential: If OR9A2 dysfunction contributes to disease processes, rather than merely serving as a biomarker, it might represent a novel therapeutic target.

  • Comparative studies across neurodegenerative conditions: Examining OR9A2 in multiple conditions with olfactory dysfunction (Alzheimer's, PD, etc.) could reveal disease-specific patterns and shared mechanisms.

What technological advances might enhance OR9A2 research?

Several emerging technologies hold promise for advancing OR9A2 research:

  • Single-cell RNA sequencing: This technology enables analysis of OR9A2 expression at the individual cell level, potentially revealing heterogeneity within olfactory neurons that might be missed in bulk tissue analysis.

  • CRISPR-Cas9 gene editing: Precise modification of OR9A2 in cellular models can help elucidate structure-function relationships and create improved models for studying receptor properties.

  • Cryo-electron microscopy: This technique has revolutionized GPCR structural biology and could potentially reveal the three-dimensional structure of OR9A2, facilitating rational drug design and ligand discovery.

  • Organ-on-chip technology: Microfluidic devices mimicking the olfactory epithelium might provide more physiologically relevant systems for studying OR9A2 function compared to conventional cell culture.

  • Advanced imaging techniques: Methods like calcium imaging with genetically encoded indicators allow real-time visualization of OR9A2 activation in living cells with improved sensitivity and temporal resolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.