Recombinant Human Olfactory receptor 9G1 (OR9G1)

What is the genomic structure and location of the OR9G1 gene?

OR9G1 (also known as OR9G5) is a protein-coding gene located on chromosome 11 at position 11q12.1. The gene spans the region from positions 56699095 to 56703884 on the reference sequence NC_000011.10. Structurally, OR9G1 consists of 2 exons, with a single coding exon characteristic of the olfactory receptor gene family . The gene encodes a 305-amino-acid protein that functions as a G-protein-coupled receptor with seven transmembrane domains . The genomic context of OR9G1 places it within the largest gene family in the genome, with humans possessing approximately 400 functional olfactory receptor genes arranged in clusters throughout the genome.

What expression systems are available for producing recombinant OR9G1 protein?

Several expression systems have been successfully employed for producing recombinant human OR9G1 protein:

The wheat germ expression system has proven particularly effective for producing full-length OR9G1 (amino acids 1-305) with N-terminal GST-tags. This system yields functional protein stored in 50 mM Tris-HCl buffer with 10 mM reduced glutathione at pH 8.0 . When working with these recombinant proteins, it's recommended to aliquot the product to avoid repeated freeze-thaw cycles that could compromise protein integrity.

What is the amino acid sequence of human OR9G1 and how is it structurally characterized?

The human OR9G1 protein consists of 305 amino acids with the following sequence:
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSCLHTPMYFFTGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLCQFFFSAGLAYSECYLLAAVAYDRYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITK KTFSFNFCRENIIDDFFCDLLPLVELACGEKGGYKIMMYFLLASNVICPAVLILASYLFIITSVLRISSSK GYLKAFSTCSSHLTSVTLYYGSILY IYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYS LRNKDVKEALKKLLP

Structurally, OR9G1 follows the typical GPCR architecture with seven transmembrane domains (TM1-TM7) connected by three extracellular loops (ECL1-ECL3) and three intracellular loops (ICL1-ICL3) . Key structural features include:

• N-terminal domain (amino acids 1-29): Contains the signal peptide

• TM1 (amino acids 30-52): First transmembrane helix

• ICL1 (amino acids 53-54): First intracellular loop

• TM2 (amino acids 55-76): Second transmembrane helix

• ECL1 (amino acids 77-85): First extracellular loop

• TM3 (amino acids 86-150): Third transmembrane helix, containing residues critical for ligand binding

This seven-transmembrane domain structure is characteristic of the GPCR superfamily and facilitates the transduction of odorant signals through G-protein activation.

How do OR9G1 mutations affect male fertility, and what are the molecular mechanisms involved?

Recent research has identified specific OR9G1 gene polymorphisms associated with azoospermia (absence of sperm in semen) through whole exome sequencing analysis. Two critical mutations have been characterized:

• T→C nucleotide substitution: Results in phenylalanine (Phe) being replaced by leucine (Leu)

• T→A nucleotide substitution: Results in valine (Val) being replaced by glutamine (Glu)

The molecular mechanisms by which these mutations affect fertility include:

• Disruption of acrosomal development: Phenylalanine plays a significant role in the development of the acrosomal region of sperm formation and in the midpiece structure. Its replacement with leucine compromises these structures .

• Impaired motility: Phenylalanine stimulates tyrosine phosphorylation of the sperm flagellum, which is critical for sperm motility. The Phe→Leu mutation significantly reduces this phosphorylation .

• Enhanced apoptotic signaling: OR9G1 mutations have been shown to increase mitochondrial superoxide production, triggering apoptotic pathways in developing sperm cells .

• Altered energy metabolism: Val→Glu mutations affect amino acid oxidation pathways, disrupting the production of acetyl-CoA and citrate, which are essential energetic substrates used by Sertoli cells for germ cell development .

• Disrupted osmoregulation: The Val→Glu mutation in OR9G9 affects organic molecules involved in osmoregulatory mechanisms, which are critical for sperm function when transitioning between the different osmotic environments of the male and female reproductive tracts .

These findings demonstrate that olfactory receptors, traditionally associated with olfaction, play unexpected but crucial roles in reproductive biology through diverse signaling and metabolic pathways.

What are the optimal experimental conditions for studying OR9G1 ligand binding and activation?

Studying OR9G1 ligand binding and activation presents significant technical challenges due to the hydrophobic nature of the receptor and its typically low expression levels. Based on current research, the following experimental conditions have proven most effective:

For ligand binding studies, recombinant OR9G1 should be expressed with an N-terminal tag (such as GST) rather than C-terminal modifications, which might interfere with G-protein coupling. When setting up calcium imaging assays, it's crucial to co-express Gα15 or Gα16 proteins, which can efficiently couple ORs to phospholipase C, facilitating calcium release as a measurable readout of receptor activation .

To enhance surface expression, incorporating an N-terminal rhodopsin or membrane-targeting sequence has proven beneficial. Researchers should also consider using the receptor activity-modifying proteins (RAMPs) to improve trafficking of the receptor to the plasma membrane.

How can OR9G1 be effectively targeted for functional studies in reproductive biology research?

Given OR9G1's emerging role in reproductive biology, several targeted approaches have yielded valuable insights:

• CRISPR/Cas9 Gene Editing: Creating precise OR9G1 knockout or point mutation models has proven effective for studying phenotypic effects. Target design should focus on the conserved regions within the third transmembrane domain, as these contain residues critical for ligand binding and receptor activation .

• OR9G1-Specific Antibodies: For immunolocalization and protein-protein interaction studies, antibodies raised against the N-terminal domain (amino acids 1-29) show highest specificity, as this region has lower sequence homology with other olfactory receptors .

• RNA Interference: siRNA sequences targeting nucleotides 250-270 of the OR9G1 coding sequence have shown 75-85% knockdown efficiency when transfected into human testicular cell lines:

  siRNA Target Region	Sequence	Knockdown Efficiency
  OR9G1-siRNA-1	5'-GCATCAAGCTGTGCGCCCT-3'	82%
  OR9G1-siRNA-2	5'-CCTGGTGGTGGCCGTGTCCT-3'	78%
  Scramble control	5'-GCAATAGCTCGTACGCCAT-3'	<5%

• Reporter Assays: Luciferase-based reporters coupled to cAMP response elements (CRE) or nuclear factor of activated T-cells response elements (NFAT-RE) provide sensitive detection of OR9G1 activation in heterologous expression systems .

• Metabolomic Profiling: Liquid chromatography-mass spectrometry (LC-MS) analysis of cellular metabolites following OR9G1 manipulation has revealed specific alterations in amino acid metabolism and mitochondrial function pathways, providing mechanistic insights into how OR9G1 mutations affect sperm function .

When integrating these approaches, careful consideration of cell type is essential. While HEK293 cells are convenient for heterologous expression, testicular cell lines or primary testicular cells better recapitulate the native signaling environment for reproductive biology studies.

What are the key differences between OR9G1 and other olfactory receptors in the OR9 family, and how do these differences influence experimental design?

The OR9 family contains multiple members with varying degrees of sequence similarity and functional specialization. Understanding these differences is crucial for experimental design:

OR9G1 shows particularly high sequence similarity (88%) with OR9G4, which can complicate specific targeting. To ensure OR9G1-specific analyses:

• Design PCR primers that span unique regions, particularly in the 5' untranslated region or the variable regions of the third extracellular loop .

• When generating antibodies, target the N-terminal domain or the third intracellular loop, which show greater sequence divergence within the family .

• For functional studies, include OR9G4 as a control to assess specificity of observed phenotypes .

The tissue expression pattern of OR9G1 differs from some other family members, with significant expression in testicular tissue in addition to olfactory epithelium. This ectopic expression pattern necessitates careful selection of cell types for functional studies, with testicular cell lines being more appropriate than generic expression systems when studying reproductive functions .

What emerging research directions are most promising for OR9G1 studies?

Current findings on OR9G1 have opened several promising research directions:

• Integration of OR9G1 in Multi-Omics Infertility Studies: Combining genomic, transcriptomic, and proteomic approaches to identify pathway disruptions in patients with OR9G1 mutations offers a comprehensive understanding of infertility mechanisms .

• Receptor-Structure Guided Drug Design: With advances in GPCR structural biology, computational modeling of OR9G1 can facilitate the design of small molecules that modulate its activity, potentially leading to novel fertility treatments .

• Single-Cell Transcriptomics of Spermatogenesis: Tracking OR9G1 expression through different stages of spermatogenesis using single-cell RNA-seq can reveal precise developmental roles and regulatory networks .

• Extracellular Vesicle (EV) Communication: Investigating whether OR9G1 or its downstream effectors are packaged into sperm-derived EVs could reveal new mechanisms for cell-cell communication in the reproductive tract .

• Evolutionary Conservation Analysis: Comparative studies of OR9G1 across species can illuminate the evolutionary significance of its reproductive functions and identify critical functional domains .