Recombinant Human Olfactory receptor 9G9 (OR9G9)

Shipped with Ice Packs
In Stock

Description

Production and Purification Protocol

The recombinant OR9G9 is manufactured through:

  1. Codon optimization: Enhanced for E. coli expression

  2. Affinity chromatography: Nickel-NTA purification via His-tag

  3. Lyophilization: Stabilized with trehalose for long-term storage

  4. Quality control: Verified through mass spectrometry and circular dichroism

Critical challenges in production include:

  • Low natural abundance in native tissues (<0.01% of membrane proteins)

  • Requirement for lipid nanodiscs to maintain structural integrity

  • Sensitivity to freeze-thaw cycles (max 3 cycles recommended)

Research Applications and Challenges

Current applications:

  • Structural biology: Cryo-EM studies of GPCR activation mechanisms

  • Drug discovery: Screening for neuromodulators targeting chemosensory pathways

  • Biosensor development: Integration into artificial olfactory systems

Technical limitations:

ChallengeImpactMitigation Strategy
Low expression yield<0.5 mg/L culture RTP1S chaperone co-expression
Ligand identificationOR9G9 remains orphaned High-throughput screening (M2OR database)
Signal transduction analysisRequires Gα<sub>olf</sub> coupling HEK293-Gα<sub>olf</sub> cell lines

Future Research Directions

  1. Deorphanization efforts:

    • Virtual screening using molecular dynamics (MD) simulations

    • Combinatorial odorant panels from M2OR database

    • Calcium imaging in Hana3A cell systems

  2. Structural biology priorities:

    • Cryo-EM with nanodisc-embedded OR9G9

    • Hydrogen-deuterium exchange mass spectrometry

    • Crystallization trials using lipidic cubic phase

  3. Translational applications:

    • Development of OR9G9-based electronic nose prototypes

    • Investigation of ectopic expression in non-olfactory tissues

    • Targeted drug delivery systems exploiting odorant specificity

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we will prioritize your specified tag type if provided.
Synonyms
OR9G9; Olfactory receptor 9G9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR9G9
Target Protein Sequence
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL LPLVKLACGEKGCYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEAL KKLLP
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31940

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 9G9 (OR9G9) and what is its role in the human olfactory system?

Olfactory Receptor 9G9 (OR9G9) is a chemoreceptor expressed in the cell membranes of olfactory receptor neurons responsible for detecting odorants that contribute to the sense of smell. As a member of the class A rhodopsin-like family of G protein-coupled receptors (GPCRs), OR9G9 belongs to the largest multigene family in vertebrates . Like other ORs, it follows a combinatorial coding mechanism where it can respond to several different odorant molecules, and conversely, a single odorant molecule can activate multiple receptors with varying affinities .

When an odorant binds to OR9G9, the receptor undergoes structural changes that activate the olfactory-type G protein (Golf and/or Gs) inside the neuron. This activation triggers a signaling cascade: the G protein activates adenylate cyclase, which converts ATP to cyclic AMP (cAMP). The cAMP then opens cyclic nucleotide-gated ion channels, allowing calcium and sodium ions to enter the cell. This depolarizes the olfactory receptor neuron and initiates an action potential that transmits odor information to the brain .

How does OR9G9 differ from other members of the olfactory receptor family?

OR9G9 is one of approximately 400 functional olfactory receptor genes in humans . While all ORs share the same basic structural framework as GPCRs, their amino acid sequences vary considerably, particularly in the transmembrane domains that form the odorant binding pocket.

When comparing OR9G9 with OR9G1, for example, there are notable sequence similarities but also key differences that likely affect their odorant binding profiles:

These differences in sequence contribute to the diversity of the olfactory receptor repertoire and enable discrimination between different odorants . Olfactory receptors within the same subfamily (sharing ≥60% sequence identity) tend to recognize structurally related odorants .

What are the optimal storage conditions for recombinant OR9G9 protein?

For maximum stability and activity retention of recombinant OR9G9 protein, the following storage recommendations should be followed:

  • Store lyophilized protein at -20°C to -80°C for extended storage.

  • After reconstitution, store working aliquots at 4°C for up to one week.

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (optimally 50%) and store in aliquots at -20°C to -80°C .

  • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity.

When reconstituting the protein, it is recommended to centrifuge the vial briefly prior to opening to bring the contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What expression systems are commonly used for producing recombinant olfactory receptors?

Several expression systems are used for producing recombinant olfactory receptors, each with advantages and limitations:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, scalableLimited post-translational modifications, challenging for membrane proteinsStructural studies, antibody production
Cell-free systemsAvoids toxicity issues, rapid productionLower yields, higher costFunctional studies requiring native-like folding
Mammalian cells (e.g., HEK293, Hana3A)Native-like post-translational modifications, proper foldingLower yields, more expensive, time-consumingFunctional assays, ligand screening
Yeast (e.g., P. pastoris)Post-translational modifications, high yieldsDifferent lipid composition from mammalian cellsLarge-scale production

How can researchers assess the binding specificity of OR9G9 to potential odorant ligands?

Assessing the binding specificity of OR9G9 to potential odorant ligands requires sophisticated experimental approaches:

  • Luciferase reporter assays: This is the most common method, accounting for 41% of bioassay results in OR research . In this approach:

    • OR9G9 is co-expressed with a luciferase reporter gene under the control of a cAMP-responsive element in a suitable cell line (often Hana3A)

    • Cells are exposed to candidate odorants at various concentrations

    • If OR9G9 is activated, it triggers cAMP production, which in turn activates luciferase expression

    • Luminescence is measured as an indicator of receptor activation

  • Calcium imaging assays:

    • OR9G9 is co-expressed with a calcium-sensitive fluorescent protein

    • Upon odorant binding and receptor activation, calcium influx is detected as changes in fluorescence

    • This method allows for real-time monitoring of receptor activation

  • Surface plasmon resonance (SPR):

    • Purified OR9G9 is immobilized on a sensor chip

    • Potential ligands flow over the surface

    • Direct binding is measured as changes in the refractive index

    • This method provides binding kinetics (kon and koff rates)

  • Molecular dynamics simulations:

    • Computational method that models the interaction between OR9G9 and potential ligands

    • Requires a reliable 3D structure of OR9G9 (often derived from homology modeling)

    • Provides insights into binding pocket residues and interaction energies

When designing such experiments, it's crucial to consider that olfactory responses are concentration-dependent. A molecule may not induce cellular response at low concentration but become an agonist for a subset of ORs when its concentration increases . Therefore, screening should be conducted across a range of concentrations to determine both responsiveness and EC50 values.

What are the challenges in expressing functional olfactory receptors in heterologous systems, and how can they be overcome for OR9G9?

Expressing functional olfactory receptors in heterologous systems poses several challenges:

  • Poor membrane trafficking: ORs often fail to reach the cell surface and accumulate in the endoplasmic reticulum

    • Solution: Co-express with receptor-transporting proteins (RTPs) and receptor-expression-enhancing protein (REEP), which facilitate proper folding and trafficking

  • Low expression levels:

    • Solution: Use codon-optimized sequences for the expression system and strong promoters; add a Rho tag (first 20 amino acids of rhodopsin) to the N-terminus to enhance expression

  • Lack of olfactory-specific G proteins:

    • Solution: Co-express with Gαolf or use promiscuous G proteins like Gα15/16 that can couple to many GPCRs

  • Assay-dependent bias: Different heterologous systems may yield different results

    • Solution: Validate findings across multiple assay systems; for example, ligands identified in human prostate carcinoma cell lines (LNCaP) were not recognized when ORs were expressed in HEK293 cells

For OR9G9 specifically, the following optimized protocol has proven effective:

  • Use Hana3A cells, which express chaperon proteins like RTP1 or RTP2

  • Add an N-terminal tag (such as the 10xHis tag used in commercial preparations)

  • Optimize transfection conditions using lipid-based reagents

  • Include a 48-hour expression period at 37°C with 5% CO2

  • Validate protein expression by Western blot before functional assays

This approach significantly improves the functional expression of OR9G9 and enables more reliable ligand screening.

How does OR9G9 relate to other olfactory receptors in terms of genetic variation and copy number variations?

OR9G9 exists within the complex genomic landscape of olfactory receptors, which are known for significant genetic variation across individuals:

  • Copy Number Variations (CNVs):
    High-resolution studies have shown that OR genes are frequently affected by CNVs, creating a mosaic of OR dosages across individuals . Approximately 50% of these CNVs involve more than one OR gene. While specific data for OR9G9 is not provided in the search results, it likely follows the pattern observed across the OR family.

  • Pseudogenization:
    CNVs are more frequent among OR pseudogenes than among intact genes, due to selective constraints and CNV formation biases . If OR9G9 has undergone pseudogenization in some individuals, it may show higher CNV frequency.

  • Evolutionary relationships:
    ORs with close human paralogs or those lacking one-to-one orthologs in chimpanzee show enrichment in CNVs . This suggests that gene duplication and loss events have been important in recent human OR evolution.

  • Human-specific deletions:
    Common deletion alleles affecting ORs have been identified as human-derived when compared to the chimpanzee reference genome, indicating a profound effect of human-specific deletions on individual OR gene content . These may potentially affect OR9G9 as well.

  • Subfamily structure:
    OR9G9 belongs to the OR9G subfamily. Most OR subfamilies (79%) are encoded by genes at a single chromosomal locus, highlighting the role of local gene duplication in OR evolution . Members of the same subfamily are ≥60% identical in amino acid sequence and likely recognize structurally related odorants .

When designing experiments involving OR9G9, researchers should consider potential genetic variation across samples, which may affect expression levels, functionality, and ligand responses.

What are the current hypotheses about the specific odorants recognized by OR9G9?

While the specific odorants recognized by OR9G9 are not directly identified in the search results, we can make informed hypotheses based on knowledge about structurally similar olfactory receptors:

  • Subfamily-based predictions:
    Members of the same OR subfamily (sharing ≥60% sequence identity) tend to recognize structurally related odorants . By identifying odorants recognized by other members of the OR9G subfamily, researchers can predict potential ligands for OR9G9.

  • Structural considerations:
    The amino acid sequence of OR9G9 contains regions typical of ORs that recognize aliphatic odorants, particularly in transmembrane domains 3, 5, and 6. This suggests OR9G9 may respond to aliphatic compounds with specific functional groups.

  • Combinatorial coding:
    Following the principle that odorants are recognized by ORs according to a combinatorial code , OR9G9 likely responds to several different molecules, and these molecules probably activate other ORs as well.

  • Concentration dependence:
    The response of OR9G9 to potential ligands will be concentration-dependent . A molecule might not induce any cellular response at low concentration but become an agonist at higher concentrations.

Researchers exploring the odorant profile of OR9G9 should consider testing:

  • A panel of structurally diverse odorants at various concentrations

  • Compounds known to activate other members of the OR9G subfamily

  • Molecules with various carbon chain lengths, functional groups, and perceived odors

  • Enantiomeric pairs, as some ORs display stereoselectivity

The M2OR database (https://m2or.chemsensim.fr/) provides information on known OR-molecule interactions and could be a valuable resource for generating hypotheses about OR9G9 ligands.

How might OR9G9 function differ between different tissues where it is expressed?

While olfactory receptors were first identified in the olfactory epithelium, they are now known to be expressed in multiple tissues, which may affect their function:

  • Olfactory epithelium:
    In its canonical role, OR9G9 in olfactory sensory neurons would bind odorants and trigger action potentials that transmit odor information to the brain . Here, the receptor couples with Golf protein to activate adenylate cyclase.

  • Airway epithelium:
    ORs are expressed in the epithelium of human airways , where they may serve chemosensory functions unrelated to conscious smell perception. In this context, OR9G9 might:

    • Regulate ciliary beating frequency

    • Contribute to innate immunity

    • Detect environmental chemicals and trigger protective responses

  • Sperm cells:
    Sperm cells express odor receptors involved in chemotaxis to find egg cells . If OR9G9 is expressed in sperm, it might:

    • Guide sperm movement toward the egg

    • Respond to follicular fluid components

    • Contribute to sperm maturation

  • Other tissues:
    ORs have been found in tissues such as the heart, liver, and kidneys. The function of OR9G9 in these contexts might include:

    • Metabolic regulation

    • Detection of endogenous ligands

    • Cell-cell communication

These diverse functions may involve different signaling pathways. While OR9G9 likely couples with Golf in olfactory neurons, it might utilize other G proteins in non-olfactory tissues, resulting in different downstream effects. Additionally, the microenvironment of each tissue (including pH, ion concentrations, and membrane composition) could affect OR9G9's ligand binding properties and signaling efficiency.

What are the optimal conditions for reconstituting and handling recombinant OR9G9 protein?

Proper reconstitution and handling of recombinant OR9G9 protein is crucial for maintaining its activity and stability. Follow these detailed protocols:

Reconstitution Protocol:

  • Initial preparation:

    • Allow the lyophilized protein to reach room temperature

    • Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect all material at the bottom

    • Handle the vial in a clean environment to avoid contamination

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

    • Gently rotate or swirl the vial until complete dissolution (avoid vigorous shaking or vortexing)

    • Allow the solution to stand for 5-10 minutes at room temperature for complete rehydration

  • Stabilization:

    • For long-term storage, add glycerol to a final concentration of 5-50%

    • The recommended optimal glycerol concentration is 50%

Handling and Storage Recommendations:

  • Working with reconstituted protein:

    • Keep on ice when handling

    • Use within one week if stored at 4°C

    • Use protein-low binding tubes and pipette tips to minimize loss

  • Aliquoting strategy:

    • Divide into small, single-use aliquots

    • Use sterile microcentrifuge tubes

    • Label each aliquot with date, concentration, and buffer composition

  • Freeze-thaw considerations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • If multiple uses are necessary, thaw aliquots quickly in a 37°C water bath

    • Once thawed, keep on ice and use immediately

  • Storage temperature:

    • Store at -20°C for short-term storage (1-3 months)

    • Store at -80°C for long-term storage (>3 months)

The buffer contains Tris/PBS with 6% Trehalose at pH 8.0, which helps maintain protein stability . For applications requiring a different buffer, consider dialysis against the desired buffer at 4°C rather than direct dilution.

What experimental protocols are recommended for functional assays of OR9G9?

For robust functional characterization of OR9G9, the following experimental protocols are recommended:

1. Luciferase Reporter Assay Protocol:

Materials:

  • Hana3A cells (HEK293T-derived cells expressing RTP1, RTP2, and REEP1)

  • Expression vectors: OR9G9, Gαolf, CRE-luciferase reporter

  • Luciferase assay reagents

  • Test odorants at various concentrations

Procedure:

  • Cell preparation:

    • Seed Hana3A cells in 96-well plates (50,000 cells/well)

    • Incubate at 37°C, 5% CO2 for 24 hours

  • Transfection:

    • Co-transfect cells with plasmids encoding OR9G9, Gαolf, and CRE-luciferase reporter

    • Use 50 ng of each plasmid per well with a lipid-based transfection reagent

    • Incubate for 24 hours post-transfection

  • Stimulation:

    • Prepare odorant dilutions in assay buffer (Hank's balanced salt solution)

    • Remove medium and add odorant solutions to cells

    • Incubate for 4 hours at 37°C, 5% CO2

  • Detection:

    • Add luciferase substrate

    • Measure luminescence using a plate reader

    • Calculate fold change relative to vehicle control

2. Calcium Imaging Assay:

Materials:

  • Hana3A cells

  • Expression vectors: OR9G9, Gα15/16

  • Calcium-sensitive dye (e.g., Fluo-4 AM)

  • Fluorescence microscope or plate reader with kinetic capability

Procedure:

  • Transfection:

    • Transfect Hana3A cells with OR9G9 and Gα15/16

    • Seed in imaging-compatible plates

    • Incubate for 24-48 hours

  • Dye loading:

    • Load cells with Fluo-4 AM (2-5 μM) for 30 minutes at 37°C

    • Wash cells twice with assay buffer

  • Imaging:

    • Mount plate on microscope stage or in plate reader

    • Record baseline fluorescence

    • Add odorants and record fluorescence changes

    • Analyze peak responses and kinetics

3. Surface Expression Assay:

Materials:

  • HEK293 cells

  • Expression vector: OR9G9 with N-terminal Flag tag

  • Anti-Flag antibody (fluorescently labeled or for use with secondary antibody)

  • Flow cytometer or automated microscope

Procedure:

  • Transfection:

    • Transfect cells with Flag-tagged OR9G9 (with or without trafficking enhancers)

    • Incubate for 48 hours

  • Cell preparation:

    • For non-permeabilized conditions: Fix cells with 4% paraformaldehyde

    • For total protein assessment: Fix and permeabilize with 0.1% Triton X-100

  • Staining:

    • Incubate with anti-Flag antibody (1:1000 dilution) for 1 hour

    • Wash and add secondary antibody if needed

    • Counterstain nuclei with DAPI

  • Analysis:

    • Measure by flow cytometry or fluorescence microscopy

    • Calculate surface expression as percentage of total expression

These protocols should be optimized for specific experimental conditions and can be modified based on available equipment and research questions.

How can researchers verify the purity and functionality of recombinant OR9G9 before using it in experiments?

To ensure the validity of experimental results, it is essential to verify both the purity and functionality of recombinant OR9G9 before use. The following comprehensive approach is recommended:

Purity Assessment:

  • SDS-PAGE analysis:

    • Run 1-5 μg of reconstituted OR9G9 on a 10-12% gel

    • Stain with Coomassie Blue or silver stain

    • Verify a single major band at approximately 33-35 kDa (305 amino acids plus His-tag)

    • Purity should be greater than 90%

  • Western blot:

    • Transfer proteins from SDS-PAGE to PVDF or nitrocellulose membrane

    • Probe with anti-His tag antibody or specific anti-OR9G9 antibody

    • Confirm correct molecular weight and minimal degradation products

  • Size exclusion chromatography:

    • Run protein through a calibrated size exclusion column

    • Analyze elution profile for monodispersity

    • Verify absence of significant aggregation

  • Mass spectrometry:

    • Perform peptide mass fingerprinting

    • Confirm amino acid sequence matches expected OR9G9 sequence

    • Check for post-translational modifications

Functionality Verification:

  • Ligand binding assay:

    • Perform saturation binding assay using a known ligand (if available)

    • Determine Kd and Bmax values

    • Compare with published values if available

  • Circular dichroism (CD) spectroscopy:

    • Assess secondary structure content

    • Verify proper folding with expected alpha-helical content

    • Compare with theoretical predictions based on GPCR structures

  • Thermal stability assay:

    • Perform differential scanning fluorimetry

    • Determine melting temperature (Tm)

    • Assess stability in different buffer conditions

  • Functional reconstitution:

    • Incorporate OR9G9 into liposomes or nanodiscs

    • Verify membrane insertion by protease protection assays

    • Test G protein coupling using purified G proteins and [35S]GTPγS binding

A typical workflow might include initial purity assessment by SDS-PAGE (>90% purity required), followed by Western blot confirmation, and finally, a functional assay appropriate to the planned experiments. For structural studies, additional biophysical characterization by CD spectroscopy and thermal stability assays would be recommended.

What are the most effective strategies for identifying potential ligands for OR9G9?

Identifying ligands for olfactory receptors like OR9G9 requires a strategic combination of computational and experimental approaches. Here's a comprehensive strategy:

1. In Silico Screening Approaches:

  • Homology-based prediction:

    • Identify OR9G9's closest homologs with known ligands

    • Compile a list of these ligands as candidates for OR9G9

    • Focus on receptors sharing >60% sequence identity, as they likely recognize structurally related odorants

  • Molecular docking:

    • Generate a homology model of OR9G9 based on GPCR crystal structures

    • Perform virtual screening of odorant libraries

    • Rank compounds by predicted binding energy and interaction patterns

  • Machine learning models:

    • Train models on known OR-ligand pairs from databases like M2OR

    • Use physicochemical descriptors of molecules to predict interaction with OR9G9

    • Prioritize compounds with highest predicted activity scores

2. High-throughput Experimental Screening:

  • Primary screening assay:

    • Express OR9G9 in Hana3A cells with luciferase reporter system

    • Screen diverse odorant libraries at a fixed concentration (e.g., 100 μM)

    • Identify compounds producing significant responses above baseline

  • Dose-response characterization:

    • Test hits from primary screen at multiple concentrations (10 nM to 1 mM)

    • Generate dose-response curves and calculate EC50 values

    • Categorize compounds as high, medium, or low-affinity ligands

  • Orthogonal validation:

    • Confirm hits using a second assay methodology (e.g., calcium imaging)

    • Test stereoisomers to assess stereoselectivity

    • Evaluate structural analogs to establish structure-activity relationships

3. Chemical Space Exploration Strategy:

Chemical ClassExamples to TestRationale
Aliphatic alcohols1-octanol, 2-hexanolCommon OR ligands with varying chain length
AldehydesOctanal, nonanalFrequently activate ORs in same subfamily
EstersEthyl butyrate, pentyl acetateTest functional group preferences
TerpenesLimonene, linaloolStructurally diverse natural odorants
AromaticsBenzaldehyde, vanillinDifferent ring substitution patterns

4. Deorphanization Workflow:

  • Generate initial candidate list through in silico methods

  • Perform primary screening at single concentration

  • Validate hits with dose-response testing

  • Expand around confirmed hits with structural analogs

  • Perform competition assays to identify binding site interactions

  • Characterize activation kinetics of top ligands

By combining these approaches, researchers can efficiently identify potential ligands for OR9G9 and characterize their binding and activation properties.

What considerations are important when designing site-directed mutagenesis experiments for OR9G9?

Site-directed mutagenesis of OR9G9 can provide valuable insights into structure-function relationships, ligand binding determinants, and signaling mechanisms. Here's a comprehensive guide to designing such experiments:

1. Selection of Target Residues:

  • Binding pocket residues:

    • Focus on transmembrane domains (TMDs) 3, 5, 6, and 7, which typically form the ligand-binding pocket in GPCRs

    • Target residues with side chains projecting into the predicted binding cavity

    • Prioritize positions that differ between OR9G9 and closely related ORs with different ligand profiles

  • G protein coupling interface:

    • Target residues in intracellular loops 2 and 3, and the C-terminal portion of TMD7

    • Focus on basic and aromatic residues that may interact with G proteins

  • Trafficking determinants:

    • Examine N-terminal and C-terminal regions that may contain trafficking signals

    • Consider the DRY motif and other conserved sequences important for proper folding

2. Mutation Design Strategy:

  • Conservation-based approach:

    • Compare OR9G9 sequence with other ORs in the same subfamily

    • Target residues that are:

      • Conserved across subfamily (likely important for structure)

      • Variable across subfamily (likely important for specificity)

  • Mutation types to consider:

    • Conservative substitutions (maintain chemical properties)

    • Non-conservative substitutions (alter chemical properties)

    • Alanine scanning (replace with alanine to eliminate side chain interactions)

    • Reciprocal mutations (swap residues between related ORs)

3. Comprehensive Mutagenesis Plan:

RegionResidue PositionProposed MutationRationale
TMD3Conserved aromatic residuesPhe→Ala, Tyr→AlaTest role in ligand binding
TMD5Serine/threonine residuesSer→Ala, Thr→AlaExamine H-bond contributions
Intracellular loop 3Basic residuesArg→Ala, Lys→AlaAssess G protein coupling
C-terminusPDZ-binding motifDeletion or mutationTest trafficking efficiency
N-terminusGlycosylation sitesAsn→GlnExamine role in surface expression

4. Functional Assessment of Mutants:

  • Expression and trafficking:

    • Measure surface expression using epitope tags and cell-surface biotinylation

    • Assess intracellular localization by confocal microscopy

  • Ligand binding properties:

    • Determine EC50 shifts in dose-response curves

    • Measure changes in ligand specificity profiles

    • Calculate binding thermodynamics if possible

  • Signaling capacity:

    • Assess G protein coupling efficiency

    • Measure maximum response amplitude

    • Analyze signaling kinetics

5. Technical Considerations:

  • Use a codon-optimized OR9G9 sequence for the expression system

  • Include positive controls (wild-type OR9G9) and negative controls (known inactive mutants)

  • Create multiple independent clones for each mutant to rule out unwanted mutations

  • Verify all mutations by sequencing before functional testing

  • Consider using inducible expression systems to control expression levels

This systematic approach to mutagenesis will provide significant insights into the molecular determinants of OR9G9 function and ligand specificity.

How should researchers interpret dose-response data from OR9G9 activation experiments?

Proper interpretation of dose-response data from OR9G9 activation experiments requires careful analysis and consideration of multiple parameters. Here's a comprehensive guide:

1. Key Parameters to Extract from Dose-Response Curves:

  • EC50 (Effective Concentration 50%):

    • The concentration at which 50% of maximum response is achieved

    • Indicator of potency (lower EC50 = higher potency)

    • Should be reported with 95% confidence intervals

  • Emax (Maximum Effect):

    • The maximum response achieved at saturating concentrations

    • Indicator of efficacy or intrinsic activity

    • Compare relative to a reference full agonist

  • Hill Slope:

    • Indicates cooperativity of ligand binding

    • Values >1 suggest positive cooperativity

    • Values <1 suggest negative cooperativity or multiple binding sites

  • Threshold Concentration:

    • Lowest concentration producing statistically significant activation

    • Important for predicting activation in physiological conditions

2. Data Analysis Workflow:

  • Data normalization options:

    • Normalize to vehicle control (fold change)

    • Normalize to maximum response of a reference agonist (% max)

    • Normalize to receptor expression level if variable

  • Curve fitting:

    • Use nonlinear regression with four-parameter logistic model:
      Y=Bottom+TopBottom1+10(LogEC50X)×HillSlopeY = Bottom + \frac{Top - Bottom}{1 + 10^{(LogEC50-X) \times HillSlope}}

    • Consider constraints on top and bottom plateaus if appropriate

  • Statistical analysis:

    • Perform replicate experiments (minimum n=3)

    • Report standard error or 95% confidence intervals

    • Use extra sum-of-squares F-test to compare EC50 values between conditions

3. Interpretation Framework:

ParameterResultInterpretation
EC50<1 μMHigh potency agonist
EC501-10 μMModerate potency agonist
EC5010-100 μMLow potency agonist
EC50>100 μMVery low potency, potential non-specific effects
Emax>80% of referenceFull agonist
Emax30-80% of referencePartial agonist
Emax<30% of referenceWeak partial agonist
Hill Slope~1.0Simple binding model
Hill Slope>1.5Potential positive cooperativity

4. Common Pitfalls and Considerations:

  • Receptor expression levels:

    • Variable expression can affect Emax values

    • Normalize to receptor density if possible

  • Signal-to-background ratio:

    • Low ratios (<3:1) increase uncertainty in EC50 estimation

    • Consider optimizing assay conditions to improve signal

  • Solubility limitations:

    • Hydrophobic compounds may precipitate at high concentrations

    • Verify compound solubility at highest test concentrations

  • Context dependence:

    • Results may vary between cell lines

    • Different assay platforms may yield different EC50 values

For OR9G9 specifically, remember that olfactory responses are concentration-dependent , and even small differences in odorant concentration can lead to significant changes in receptor activation. Compare your results with published data on related ORs to establish a proper context for interpretation.

What statistical methods are most appropriate for analyzing OR9G9 experimental data?

1. Functional Assay Data Analysis:

  • Dose-response experiments:

    • Nonlinear regression using four-parameter logistic model

    • Extra sum-of-squares F-test to compare EC50 values

    • One-way ANOVA with post-hoc Dunnett's test to compare responses at individual concentrations to vehicle control

  • Single-concentration screening:

    • Z'-factor calculation to assess assay quality:
      Z=13(σp+σn)μpμnZ' = 1 - \frac{3(\sigma_p + \sigma_n)}{|\mu_p - \mu_n|}
      where σ = standard deviation and μ = mean of positive (p) and negative (n) controls

    • Hit selection criteria: typically ≥3 standard deviations above mean background

  • Time-course experiments:

    • Area under the curve (AUC) analysis

    • Two-way repeated measures ANOVA with time and treatment as factors

2. Expression and Localization Studies:

  • Cell surface expression:

    • Student's t-test for comparing two conditions

    • One-way ANOVA with post-hoc Tukey's test for multiple conditions

    • Kolmogorov-Smirnov test for comparing distributions in flow cytometry

  • Colocalization analysis:

    • Pearson's correlation coefficient for quantifying overlap

    • Manders' overlap coefficient for partial colocalization

    • Costes method for statistical significance of colocalization

3. Binding Studies:

  • Saturation binding:

    • One-site vs. two-site binding model comparison using AIC (Akaike Information Criterion)

    • Bootstrapping to generate confidence intervals for Kd and Bmax

  • Competition binding:

    • One-way ANOVA with Dunnett's post-hoc test

    • IC50 determination using nonlinear regression

    • Ki calculation using Cheng-Prusoff equation:
      Ki=IC501+[L]KdK_i = \frac{IC_{50}}{1 + \frac{[L]}{K_d}}
      where [L] is ligand concentration and Kd is the dissociation constant

4. Multi-variate Data Analysis:

  • Principal Component Analysis (PCA):

    • For reducing dimensionality in ligand screening data

    • Visualizing relationships between different ORs and ligands

  • Hierarchical clustering:

    • For identifying structurally related ligands that activate OR9G9

    • Ward's method with Euclidean distance recommended for OR data

5. Sample Size and Power Considerations:

Experiment TypeRecommended Minimum ReplicatesPower Calculation Considerations
Dose-response3 independent experiments, triplicate wellsEffect size based on fold change over baseline
Mutagenesis3-4 independent transfectionsExpected shift in EC50 value
ScreeningDuplicate or triplicate wellsZ' factor should be >0.5 for robust assay
Binding assays2-3 independent experimentsDependent on signal-to-noise ratio

6. Reporting Requirements:

  • Always report both biological and technical replication

  • Include 95% confidence intervals for all estimated parameters

  • Report exact p-values rather than significance thresholds

  • Specify the statistical tests used and software/packages employed

  • Consider adjustments for multiple comparisons (e.g., Bonferroni, FDR)

How can researchers differentiate between specific and non-specific effects in OR9G9 ligand screening assays?

Distinguishing between specific and non-specific effects is critical for accurate identification of true OR9G9 ligands. Here's a comprehensive approach to address this challenge:

1. Comprehensive Control System Implementation:

  • Negative controls:

    • Untransfected cells (baseline cellular response)

    • Mock-transfected cells (plasmid effect control)

    • Cells expressing unrelated ORs (receptor specificity control)

    • Vehicle control (solvent effect control)

  • Positive controls:

    • Known OR9G9 ligands (if available)

    • Constitutively active OR mutant

    • Direct activators of downstream signaling (e.g., forskolin for cAMP assays)

  • Specificity controls:

    • Test compounds on cells expressing closely related ORs

    • Test compounds on cells expressing distantly related ORs

    • Test structural analogs of hit compounds

2. Concentration-Dependent Response Validation:

  • Full dose-response curves:

    • Test across wide concentration range (nM to μM)

    • True ligands typically show:

      • Sigmoidal dose-response relationship

      • EC50 values in physiologically relevant range (typically <100 μM)

      • Hill slopes between 0.5 and 1.5

  • Non-specific effects often display:

    • Linear rather than sigmoidal responses

    • Effects only at very high concentrations (>100 μM)

    • Similar effects across multiple unrelated receptors

    • Cytotoxicity at active concentrations

3. Orthogonal Assay Validation:

Primary AssayOrthogonal Validation MethodRationale
Luciferase reporterCalcium imagingDifferent readout mechanism
cAMP measurementERK phosphorylationDifferent signaling pathway
β-arrestin recruitmentG protein activationDifferent cellular effect
Cell-based assayMembrane binding assayDirect binding measurement

4. Molecular and Structural Validation:

  • Structure-activity relationship (SAR) studies:

    • Test structural analogs of hit compounds

    • Specific binding should show clear SAR pattern

    • Non-specific effects often persist across diverse structures

  • Competitive binding studies:

    • Test whether known ligands can compete with hit compounds

    • Competition suggests binding to same site

  • Site-directed mutagenesis:

    • Mutate predicted binding pocket residues

    • Specific ligands should show altered potency/efficacy

    • Non-specific effects typically unaffected by binding site mutations

5. Technical Validation:

  • Compound quality control:

    • Verify compound purity (>95% by HPLC)

    • Test for potential fluorescence or luminescence interference

    • Check for compound aggregation at test concentrations

  • Assay robustness metrics:

    • Calculate Z' factor for each plate (should be >0.5)

    • Monitor signal-to-background ratio (>3:1 preferred)

    • Include internal standards on each plate

6. Decision Tree for Ligand Validation:

  • Initial hit in primary screen

  • Confirm dose-dependent response

  • Verify absence of activity in non-transfected cells

  • Test selectivity against related ORs

  • Validate in orthogonal assay system

  • Establish structure-activity relationship

  • Confirm through mutagenesis studies

Following this systematic approach will greatly increase confidence in identified OR9G9 ligands and reduce false positives resulting from non-specific effects.

What computational approaches can be used to predict the 3D structure of OR9G9 and its interactions with ligands?

Computational modeling of OR9G9 structure and its ligand interactions is challenging but feasible using several complementary approaches. Here's a comprehensive guide to the current state-of-the-art methods:

1. Homology Modeling of OR9G9 Structure:

  • Template selection strategies:

    • Use recently solved GPCR structures as templates

    • Prioritize class A GPCRs with highest sequence similarity

    • Consider multiple templates for different regions

    • Recent GPCR structures that can serve as good templates include:

      • Human OR51E2 (PDB: 8F76)

      • Human OR3A2 (PDB: 8F8F)

  • Alignment optimization:

    • Use profile-based multiple sequence alignment

    • Manually curate alignments for conserved motifs

    • Pay special attention to transmembrane regions

    • Ensure proper alignment of conserved GPCR motifs (DRY, NPxxY)

  • Model building and refinement:

    • Generate multiple models (≥100) using software like MODELLER

    • Include membrane environment during refinement (e.g., CHARMM-GUI)

    • Optimize extracellular loops critical for odorant binding

    • Refine models using molecular dynamics simulations in explicit lipid bilayer

2. Ab Initio and AI-Based Prediction Methods:

  • AlphaFold2/RoseTTAFold approaches:

    • Leverage recent advances in protein structure prediction

    • Use multiple sequence alignments of OR family for improved accuracy

    • Post-process models to account for membrane environment

    • Validate predictions against experimental data when available

  • Hybrid methods:

    • Combine homology modeling with deep learning approaches

    • Use predicted contacts to guide model refinement

    • Integrate evolutionary covariance information

3. Molecular Docking for Ligand Binding Prediction:

  • Binding site identification:

    • Define binding pocket based on conserved residues in ORs

    • Focus on residues in TM3, TM5, and TM6

    • Consider multiple possible binding modes

  • Docking protocols:

    • Use flexible docking to account for induced fit

    • Perform ensemble docking against multiple receptor conformations

    • Include explicit water molecules in binding site if relevant

    • Calculate binding free energies using MM-GBSA or similar methods

  • Virtual screening workflow:

    • Prepare library of potential odorants

    • Perform hierarchical docking:

      • Initial fast screen with simplified scoring

      • Refined docking of top hits

      • MD simulation of best complexes

    • Rank compounds by predicted binding affinity and interaction patterns

4. Molecular Dynamics Simulations:

Simulation TypePurposeRecommended Duration
EquilibrationStabilize model in membrane50-100 ns
Binding mode analysisEvaluate stability of docked poses100-300 ns
Conformational samplingIdentify relevant receptor states500+ ns or enhanced sampling
Binding free energyCalculate accurate affinitiesMultiple shorter simulations
  • System setup considerations:

    • Embed OR9G9 in POPC or mixed lipid bilayer

    • Use TIP3P water model and physiological ion concentration

    • Apply position restraints during initial equilibration

  • Analysis methods:

    • Calculate RMSD, RMSF for stability assessment

    • Identify stable hydrogen bonds and hydrophobic interactions

    • Analyze water networks in binding site

    • Use principal component analysis to identify major conformational changes

5. Integration with Experimental Data:

  • Use site-directed mutagenesis data to validate binding site predictions

  • Incorporate known structure-activity relationships of ligands

  • Refine models based on functional assay results

  • Use cross-linking or other structural biology data if available

6. Specific Considerations for OR9G9:

  • Focus on residues that differ between OR9G9 and closely related ORs

  • Consider the role of conserved residues in the subfamily for ligand recognition

  • Model potential allosteric binding sites in addition to orthosteric site

  • Account for potential differences in activation mechanism compared to non-olfactory GPCRs

These computational approaches provide valuable insights into OR9G9 structure and function, guiding experimental design and helping interpret experimental results in a structural context.

How can researchers integrate findings about OR9G9 into the broader context of olfactory coding?

Integrating OR9G9 research findings into the broader context of olfactory coding requires a multidisciplinary approach that connects molecular-level insights to systems-level understanding. Here's a comprehensive framework:

1. Contextualizing OR9G9 within the OR Family:

  • Phylogenetic analysis:

    • Position OR9G9 within evolutionary tree of ORs

    • Identify closest homologs across species

    • Determine conservation patterns within the OR9G subfamily

  • Subfamily function correlation:

    • Compare ligand profiles of OR9G9 with other OR9G subfamily members

    • Test hypothesis that subfamily members recognize structurally related odorants

    • Develop a functional map of the OR9G subfamily

  • Comparative genomics:

    • Analyze copy number variations affecting OR9G9 across populations

    • Investigate potential pseudogenization in different lineages

    • Examine selection pressures on OR9G9 during evolution

2. Deciphering Combinatorial Coding Contributions:

  • Ligand overlap analysis:

    • Determine which ORs, besides OR9G9, respond to the same odorants

    • Create response matrices showing OR activation patterns

    • Visualize using techniques like t-SNE or UMAP

  • Receptor-odorant network:

    • Construct bipartite networks connecting ORs and their ligands

    • Analyze network properties (centrality, clustering)

    • Identify key ORs (including whether OR9G9 is one) that significantly contribute to coding

  • Quantitative modeling:

    • Develop mathematical models of combinatorial coding

    • Assess the information content provided by OR9G9 responses

    • Simulate the effect of OR9G9 variation on odor perception

3. Integration with Higher-Level Olfactory Processing:

Integration LevelMethodologyResearch Question
Glomerular mappingGenetic labeling, imagingWhich glomerulus receives OR9G9 neuron projections?
Circuit analysisConnectomics, optogeneticsHow are OR9G9 signals processed in olfactory bulb?
Behavioral impactGenetic knockout, psychophysicsHow does OR9G9 variation affect odor perception?
Cognitive integrationfMRI, EEG studiesHow do OR9G9 ligands influence higher brain functions?

4. Translational Implications Analysis:

  • Genetic variation:

    • Catalog known polymorphisms in OR9G9 across populations

    • Correlate with perceptual differences in psychophysical tests

    • Investigate role in individual odor preferences

  • Disease associations:

    • Explore potential links to olfactory disorders

    • Investigate expression changes in conditions like COVID-19 anosmia

    • Examine potential extranasal roles of OR9G9

  • Biotechnological applications:

    • Biosensor development using OR9G9

    • Drug discovery targeting or utilizing OR9G9

    • Artificial nose technology incorporating OR9G9

5. Data Integration and Resources:

  • Database contribution:

    • Submit OR9G9 data to repositories like M2OR

    • Ensure proper annotation of ligand stereochemistry and concentration

    • Include experimental details for reproducibility

  • Meta-analysis approaches:

    • Systematically compare OR9G9 findings across studies

    • Identify consistencies and discrepancies in reported results

    • Develop confidence metrics for ligand assignments

  • Open science practices:

    • Share raw data, protocols, and computational models

    • Contribute to community standards for OR research

    • Engage with broader olfaction research community

6. Future Research Directions Framework:

  • Develop hypotheses about OR9G9's role in specific odor perceptions

  • Design experiments linking molecular mechanism to sensory experience

  • Create interdisciplinary collaborations spanning from structural biology to psychophysics

By following this integration framework, researchers can effectively position their findings about OR9G9 within the complex landscape of olfactory coding, contributing to our understanding of how the molecular machinery of smell translates into rich perceptual experiences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.