Recombinant Human Olfactory receptor 9Q1 (OR9Q1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

OR9Q1 is a class II tetrapod-specific olfactory receptor with a canonical seven-transmembrane domain structure . The recombinant form typically includes tags such as N-terminal FLAG or C-terminal rho1D4 epitopes to facilitate purification and detection . Key features include:

PropertyDetails
Gene ID219956 (Human)
Protein Length310 amino acids (full-length)
Molecular Weight~33 kDa (observed via Western blot)
UniProt EntryQ8NGQ5
Expression SystemE. coli (in vitro)
Tag ConfigurationN-terminal 10xHis tag (common for purification)

Ligand Binding and Activation

Functional assays reveal OR9Q1’s role in odorant detection, though its specific ligands remain uncharacterized. Related olfactory receptors (e.g., OR51E1, OR2AT4) bind medium-chain fatty acids or synthetic odorants, suggesting OR9Q1 may interact with structurally similar molecules . Purification protocols involving anti-FLAG immunoaffinity chromatography and gel filtration yield monomeric and dimeric forms, with ligand-binding affinity in the micromolar range for some odorants .

Research Applications

Recombinant OR9Q1 is utilized in diverse experimental contexts:

ApplicationDetailsSource
Ligand ScreeningIntrinsic tryptophan fluorescence assays detect odorant binding .
Protein InteractionStudy of G-protein coupling mechanisms via cAMP response assays .
ImmunodetectionPolyclonal antibodies target epitopes (e.g., AA 234–283) for Western blot .
Diagnostic KitsELISA kits quantify OR9Q1 in biological samples (detection range: 0.156–10 ng/ml) .

Challenges and Future Directions

Despite advances in recombinant production, OR9Q1’s functional characterization remains limited due to:

  • Ligand specificity: Lack of identified agonists/antagonists .

  • Structural complexity: Membrane protein instability in vitro .

  • Heterogeneity: Monomer-dimer equilibria affecting crystallographic studies .

Ongoing efforts aim to resolve its 3D structure via cryo-EM or X-ray crystallography and expand ligand libraries through machine learning-based screening .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR9Q1; Olfactory receptor 9Q1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR9Q1
Target Protein Sequence
MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMY FLLSHLAFMDVCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAY DRYLAVCQPLLYVTILTQQARLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCD LPPLLKLTCGESYTQEVLIIMFAIFVIPASMVVILVSYLFIIVAIMGIPAGSQAKTFSTC TSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVIPMLNPLIYSLRNKEVKEAL RKILNRAKLS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14724

KEGG: hsa:219956

STRING: 9606.ENSP00000334934

UniGene: Hs.689841

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR9Q1 and what is its function in the human olfactory system?

OR9Q1 (olfactory receptor family 9 subfamily Q member 1) is a protein encoded by the OR9Q1 gene in humans. It functions as an olfactory receptor that interacts with odorant molecules in the nasal cavity to initiate neuronal responses triggering smell perception . As a member of the G-protein-coupled receptor (GPCR) family, OR9Q1 contains a characteristic 7-transmembrane domain structure that enables signal transduction following odorant binding .

The receptor's activation initiates a signaling cascade involving G proteins, which ultimately leads to the generation of action potentials that transmit olfactory information to the brain. This process forms the fundamental mechanism by which humans detect and discriminate between different odors. The OR9Q1 receptor is part of the largest gene family in the human genome, with the nomenclature assigned to OR9Q1 being independent of other organisms .

How is recombinant OR9Q1 typically expressed in laboratory settings?

Recombinant OR9Q1 is typically expressed using heterologous expression systems, with several methodological approaches available depending on research requirements. The most common expression systems include:

  • Mammalian cell lines: HEK293T cells are frequently used due to their high transfection efficiency and ability to perform post-translational modifications required for proper GPCR folding. Transfection can be performed using calcium phosphate, lipid-based reagents, or electroporation methods.

  • Insect cell expression systems: Sf9 or High Five cells infected with baculovirus vectors can produce higher protein yields, making them suitable for structural studies.

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris can be employed for functional studies, although mammalian-specific glycosylation patterns may be absent.

The choice of expression system should account for the protein's 7-transmembrane domain structure and the need for proper folding to maintain functional activity . Addition of a signal peptide and epitope tags (such as His, FLAG, or Rho tags) facilitates purification and detection. Expression typically requires optimization of temperature, induction time, and inclusion of additives like sodium butyrate to enhance expression levels.

What are the primary challenges in working with recombinant olfactory receptors like OR9Q1?

Working with recombinant olfactory receptors like OR9Q1 presents several significant challenges:

  • Low expression levels: As membrane proteins, olfactory receptors typically express at low levels in heterologous systems, often requiring optimization of expression conditions and codon usage.

  • Protein misfolding: The complex 7-transmembrane structure makes proper folding difficult, frequently resulting in aggregation and inclusion body formation .

  • Membrane integration issues: Achieving correct membrane insertion and topology is challenging, as olfactory receptors must be properly oriented within the lipid bilayer to function.

  • Ligand identification complexity: Unlike many GPCRs with defined ligands, olfactory receptors like OR9Q1 may respond to multiple odorants with varying affinities, making deorphanization difficult .

  • Functional assay limitations: Developing reliable assays to measure OR9Q1 activation requires specialized techniques like calcium imaging, cAMP assays, or electrophysiology.

These challenges can be addressed through strategies such as using specialized expression vectors containing rhodopsin signal sequences, employing accessory proteins to assist folding, and optimizing detergent conditions for membrane protein stabilization during purification.

How can molecular modeling approaches be used to predict OR9Q1-ligand interactions?

Molecular modeling provides powerful insights into OR9Q1-ligand interactions through a multi-step process:

  • Homology model construction: Since crystal structures for most ORs are unavailable, homology modeling using related GPCR templates (typically rhodopsin or β2-adrenergic receptor) serves as the foundation. This approach incorporates conserved amino acid motifs and site-directed mutagenesis constraints to ensure model accuracy .

  • Binding pocket identification: Analysis of the transmembrane domain identifies potential binding pockets. For OR9Q1, approximately 17 key residues within 5Å of bound odorants form the primary orthosteric pocket (poc17), with expanded pockets (poc20, poc27, poc60) encompassing additional residues at increasing distances .

  • Molecular dynamics simulations: These simulations explore conformational flexibility and ligand binding energetics, providing temporal resolution of binding events. For OR9Q1, simulations would incorporate the 7-transmembrane structure characteristic of olfactory receptors .

  • Docking studies: Virtual screening of potential odorants against the binding pocket predicts binding affinities and interaction modes. This approach has been validated for related ORs like mOR256-31 (Olfr263), which responds to multiple odorants including coumarin, R-carvone, and acetophenone .

  • Machine learning integration: Random Forest (RF) or Support Vector Machine (SVM) algorithms can identify patterns in receptor-ligand interactions, with RF models demonstrating superior performance for predicting OR-odorant pairing. These models incorporate both receptor sequence features and odorant physicochemical properties .

The resulting models provide testable hypotheses regarding critical residues for ligand recognition, which can be validated through site-directed mutagenesis and functional assays.

What site-directed mutagenesis approaches are most effective for studying OR9Q1 function?

Site-directed mutagenesis represents a critical approach for investigating OR9Q1 structure-function relationships through strategic amino acid substitutions:

  • Orthosteric pocket targeting: Priority should be given to residues within the predicted binding pocket (poc17 and poc20), as these have consistently demonstrated significant effects on odorant responses in related ORs . For OR9Q1, targeting conserved residues involved in GPCR activation, such as the DRY motif, would provide insights into signaling mechanisms.

  • Alanine scanning: Systematic replacement of residues with alanine helps identify amino acids essential for ligand binding versus those involved in structural maintenance. This approach has successfully mapped functional regions in related ORs .

  • Conservative substitutions: Replacing residues with chemically similar amino acids (e.g., Leu→Ile, Asp→Glu) helps distinguish between residues providing specific interactions versus those contributing to general pocket architecture.

  • Cross-receptor chimeras: Creating chimeric receptors by swapping domains between OR9Q1 and related ORs with known ligand specificities helps identify regions responsible for odorant selectivity.

  • Dose-response validation: Each mutation should be assessed using dose-dependent functional assays measuring calcium influx, cAMP production, or receptor internalization to quantify changes in EC50 values, efficacy, and response profiles .

This methodical approach, validated in studies of related ORs, enables mapping of ligand recognition determinants and signaling mechanisms specific to OR9Q1, ultimately contributing to understanding the molecular basis of olfactory perception.

How can proteochemometric machine learning models be applied to OR9Q1 research?

Proteochemometric machine learning models offer a sophisticated approach for predicting OR9Q1-ligand interactions by integrating receptor sequence information with ligand chemical properties:

  • Feature vector construction: Each OR9Q1-odorant pair is represented as a vector combining:

    • OR sequence descriptors: Amino acid composition, physicochemical properties, and position-specific scoring matrices, particularly focusing on transmembrane regions

    • Odorant descriptors: Molecular fingerprints, topological indices, and 3D conformational properties

    • Interaction terms: Cross-terms capturing potential synergistic effects between receptor and ligand features

  • Model architecture selection: Random Forest (RF) classifiers have demonstrated superior performance over Support Vector Machines (SVM) for olfactory receptor-ligand pairing predictions. These models classify OR-odorant pairs as "positive" or "negative" based on activation potential .

  • Training strategy: Models can be trained using known OR-odorant interaction data, including response profiles from related receptors. The approach used for similar ORs incorporated 550 receptors and 127 odorants, providing sufficient data for robust model development .

  • Validation and refinement: Model performance should be assessed through cross-validation and independent test sets, with hyperparameter optimization to improve prediction accuracy.

  • Feature importance analysis: Examining the contribution of individual features identifies critical sequence positions and chemical properties determining receptor-ligand compatibility.

This computational approach, used successfully with other ORs, enables virtual screening of potential OR9Q1 ligands, prioritizing candidates for experimental validation and accelerating deorphanization efforts. Implementations are available through platforms like the GitHub repository referenced in related studies (https://github.com/chemosim-lab/OlfactoryReceptors)[2].

What transcriptomic analysis approaches can reveal OR9Q1 expression patterns in different tissues?

Comprehensive transcriptomic analysis of OR9Q1 expression patterns can be achieved through integrated analytical approaches:

This integrated approach provides both statistical rigor and biological context for interpreting OR9Q1 expression across diverse tissues, potentially revealing unexpected expression patterns beyond olfactory epithelium.

How does the structure of OR9Q1 compare to other olfactory receptors in terms of ligand specificity?

OR9Q1's structure reveals distinctive features that influence its ligand specificity profile when compared to other olfactory receptors:

Understanding these structural determinants of OR9Q1's ligand specificity provides a foundation for rational design of specific agonists and antagonists, potentially enabling manipulation of olfactory signaling pathways for research applications.

What are the current approaches for deorphanizing OR9Q1 and identifying its natural ligands?

Deorphanizing OR9Q1 and identifying its natural ligands requires a multi-faceted strategy combining:

  • High-throughput functional screening: Systematic screening of OR9Q1 against diverse odorant libraries using calcium imaging, cAMP accumulation assays, or bioluminescence resonance energy transfer (BRET) provides the foundation for deorphanization. This approach has successfully identified ligands for numerous olfactory receptors when expressed in heterologous systems like HEK293 cells.

  • Reverse pharmacology with chemical informatics: Starting with structurally diverse odorants and progressively narrowing the chemical space based on activation patterns helps establish structure-activity relationships. Computational analysis of active compounds identifies common structural features that can guide selection of additional candidate ligands.

  • Biological context integration: Examining natural odor sources where OR9Q1 might play a significant role (e.g., food, predator, or mate odors) can narrow the search space. This approach considers the ecological and evolutionary context of olfactory perception.

  • Machine learning prediction: Proteochemometric machine learning models, particularly Random Forest classifiers, effectively predict potential OR9Q1-ligand interactions by integrating receptor sequence information with odorant chemical descriptors . These models, trained on known OR-ligand pairs, can prioritize candidates for experimental validation.

  • In vivo validation: Confirming OR9Q1 ligands through in vivo approaches, such as generating OR9Q1-knockout models or using adenoviral expression of OR9Q1 in nasal epithelium followed by electro-olfactogram recordings, provides physiological relevance to in vitro findings.

This integrated strategy optimizes resources by prioritizing the most promising ligand candidates while providing multiple lines of evidence for OR9Q1 activation.

How can OR9Q1 expression systems be optimized for structural studies?

Optimizing OR9Q1 expression systems for structural studies requires addressing several critical challenges:

  • Expression system selection: While mammalian cells provide native-like post-translational modifications, insect cell expression systems (Sf9, High Five) typically yield higher protein quantities necessary for structural studies. For OR9Q1, a baculovirus expression system with codon optimization for insect cells represents an effective starting point.

  • Fusion partner strategy: Integration of fusion partners significantly enhances membrane protein expression and stability. For OR9Q1 structural studies, consider:

    • T4 lysozyme or BRIL insertions in the third intracellular loop to stabilize the receptor in a specific conformation

    • Thermostabilized apocytochrome b562RIL (BRIL) as an N-terminal fusion

    • Addition of a C-terminal GFP tag to monitor expression and purification

  • Thermostabilization approaches: Introduction of stabilizing mutations based on computational predictions or alanine scanning increases protein stability during purification. For OR9Q1, targeting residues outside the binding pocket, particularly at helix-helix interfaces, may enhance thermostability without compromising ligand binding.

  • Detergent optimization: Systematic screening of detergents is crucial for maintaining OR9Q1 stability during extraction and purification. A detergent panel including:

    • Mild detergents (DDM, LMNG)

    • Facial amphiphiles (MNA-C12, FA-3)

    • Novel nanodisc technologies (SMALPs, peptide-based nanodiscs)
      Should be evaluated using thermal stability assays (CPM, DSF) to identify optimal conditions.

  • Ligand co-expression: Inclusion of high-affinity ligands during expression and purification often enhances GPCR stability. Once OR9Q1 ligands are identified, their incorporation throughout the purification process can significantly improve protein yield and conformational homogeneity.

These optimizations, systematically implemented and validated through stability assays and small-scale purification trials, maximize the likelihood of obtaining OR9Q1 samples suitable for structural determination through X-ray crystallography or cryo-electron microscopy.

How can contradictions in OR9Q1 functional data be reconciled across different experimental systems?

Reconciling contradictions in OR9Q1 functional data across experimental systems requires a systematic analysis of methodological variables:

  • Expression system comparison: Different host cells (HEK293, Hana3A, Sf9) express varying levels of G proteins and accessory factors that modulate receptor function. A comprehensive comparison should include:

    Expression SystemAdvantagesLimitationsG Protein Coupling Profile
    HEK293TMammalian processing, easily transfectedVariable receptor traffickingPrimarily Gαolf when co-expressed
    Hana3AEnhanced OR trafficking, RTP/REEP proteinsLess characterized than HEK293Improved coupling to endogenous G proteins
    Sf9 (insect)High expression levelsNon-mammalian glycosylationRequires exogenous G protein expression
  • Assay readout normalization: Different functional assays (calcium imaging, cAMP, luciferase) vary in sensitivity, temporal resolution, and signal amplification. Standard curves with reference agonists should be established across platforms, enabling conversion of raw data to comparable metrics (e.g., percentage of maximal response).

  • Receptor construct verification: Sequence variations, tag positions, and signal peptide choices significantly impact receptor function. Systematic documentation of:

    • Exact OR9Q1 sequence used (including any mutations)

    • Position and type of epitope tags

    • Presence of enhancing sequences (e.g., rhodopsin tags)
      Facilitates cross-study comparison.

  • Experimental condition standardization: Temperature, pH, ion concentrations, and cell density should be harmonized across laboratories. Creating a standardized OR9Q1 functional testing protocol would minimize methodological variability.

  • Statistical meta-analysis: Bayesian hierarchical modeling can integrate data across studies while accounting for systematic differences in experimental conditions, providing a unified perspective on OR9Q1 function despite methodological heterogeneity.

This systematic approach identifies whether contradictions represent true biological variability or methodological artifacts, advancing understanding of OR9Q1 function through improved experimental design and data interpretation.

How can transcriptomic profiling be used to understand OR9Q1's role in olfactory dysfunction?

Transcriptomic profiling offers powerful insights into OR9Q1's potential involvement in olfactory dysfunction through multiple analytical approaches:

These approaches, applied systematically across olfactory dysfunction conditions (anosmia, hyposmia, specific odorant insensitivity), may reveal condition-specific OR9Q1 expression signatures with diagnostic and therapeutic implications.

What is the potential role of OR9Q1 in non-olfactory tissues and disease states?

While traditionally considered olfactory-specific, emerging evidence suggests OR9Q1 may have significant functions in non-olfactory tissues with implications for disease:

  • Transcriptomic evidence across tissues: Comprehensive RNA-Seq datasets reveal OR9Q1 expression beyond the nasal epithelium. THRESHOLD analysis can identify tissues where OR9Q1 shows consistent expression patterns compared to control populations, highlighting potential functional relevance . The analysis focuses on:

    • Expression consistency (saturation) rather than just magnitude

    • Relative ranking within tissue-specific transcriptomes

    • Statistical significance of expression patterns compared to reference tissues

  • Potential physiological roles: In non-olfactory tissues, OR9Q1 may function as a chemosensor for endogenous metabolites or signaling molecules. Functional characterization should examine:

    • G-protein coupling preferences in different tissues

    • Second messenger systems activated

    • Cellular responses to receptor activation

  • Disease associations: OR9Q1 dysregulation may contribute to pathological processes through altered chemosensing. Research should investigate:

    • Expression changes in disease states using THRESHOLD's statistical comparison features

    • Genetic associations between OR9Q1 variants and disease risk

    • Functional consequences of disease-associated variants

  • Therapeutic targeting potential: If OR9Q1 plays significant roles in disease processes, it may represent a novel therapeutic target. Structure-based drug design approaches could develop:

    • Selective agonists or antagonists based on molecular modeling

    • Allosteric modulators targeting non-conserved regions

    • Expression modulators for tissues with aberrant OR9Q1 levels

This emerging area requires integration of transcriptomic data with functional validation to establish causal relationships between OR9Q1 activity and non-olfactory physiology or pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.