Recombinant Human Oligosaccharyltransferase complex subunit OSTC (OSTC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
OSTC; DC2; HDCMD45P; HSPC307; Oligosaccharyltransferase complex subunit OSTC; Hydrophobic protein HSF-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OSTC
Target Protein Sequence
METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function
Recombinant Human Oligosaccharyltransferase complex subunit OSTC (OSTC) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This represents the first step in protein N-glycosylation, a co-translational process. The OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity. OSTC may be involved in N-glycosylation of amyloid-beta precursor protein (APP) and can modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.
Gene References Into Functions
  1. DC2 and KCP2 mediate the interaction between the oligosaccharyltransferase STT3A and the endoplasmic reticulum translocon. PMID: 28860277
  2. Upregulation of OSTC/DC2, a novel component of the oligosaccharyltransferase complex, is part of the mammalian heat shock response. PMID: 24751383
Database Links

HGNC: 24448

KEGG: hsa:58505

STRING: 9606.ENSP00000354676

UniGene: Hs.445803

Protein Families
OSTC family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of human OSTC within the oligosaccharyltransferase complex?

OSTC (Oligosaccharyltransferase Complex Subunit) is a critical component of the oligosaccharyltransferase (OST) complex that catalyzes N-glycosylation of nascent polypeptides within the endoplasmic reticulum (ER). OSTC contains multiple transmembrane domains and functions primarily in conjunction with other OST subunits including STT3A and MAGT1 . Its integration within the complex is essential for the proper structural organization that enables N-glycosylation activity during protein translocation into the ER lumen.

Research has demonstrated that OSTC participates in high molecular weight complexes within the ER membrane, interacting not only with core OST subunits but also with additional proteins such as SSRD (Trap delta) . These interactions appear to be dynamically regulated and may differ between forward translocation processes and quality control mechanisms. The presence of OSTC is particularly important for the functional connection between the OST complex and ERAD machinery that targets misfolded proteins for degradation.

How does OSTC contribute to ER-associated degradation (ERAD) pathways?

OSTC makes significant contributions to ERAD pathways through several mechanisms. Research indicates that OSTC interacts directly with key ERAD components, including the E3 ubiquitin ligase HRD1, which is central to the retrotranslocation and ubiquitination of misfolded proteins . This interaction appears to be specific and functionally relevant, as demonstrated through coimmunoprecipitation experiments.

Experimental evidence shows that OSTC, along with other OST subunits, can be detected in association with ERAD substrates (such as H2a) after proteasomal inhibition and puromycin treatment . This suggests that OSTC's role in ERAD is distinct from its function during initial protein translocation and glycosylation. The current mechanistic model proposes that OSTC may aid in the retrotranslocation process by contributing to membrane distortion or thinning, similar to the mechanism proposed for the interphase between HRD1 and Der1 in yeast . This activity facilitates the movement of misfolded proteins from the ER lumen back to the cytosol for proteasomal degradation.

What experimental methods are most reliable for detecting OSTC interactions with ERAD components?

For reliable detection of OSTC interactions with ERAD components, coimmunoprecipitation (co-IP) following crosslinking represents the gold standard approach. Research demonstrates that GFP-tagged DAD1 (another OST subunit) robustly coprecipitates with myc-tagged HRD1, suggesting similar methodologies would be effective for OSTC . The specificity of these interactions can be verified by comparison with appropriate negative controls lacking the bait protein.

An optimized protocol for detecting OSTC-ERAD component interactions would include:

  • Expression of tagged versions of OSTC (e.g., GFP-OSTC) and putative interacting partners (e.g., HRD1-myc)

  • Chemical crosslinking to stabilize transient protein-protein interactions

  • Cell lysis under conditions that preserve membrane protein complexes (typically using mild detergents)

  • Immunoprecipitation using antibodies against the tag

  • Western blot analysis to detect coprecipitated proteins

Additional approaches include proximity labeling methods such as BioID, which can identify proteins in close proximity to OSTC within the native cellular environment . For example, experiments utilizing a BAP-tagged ERAD substrate demonstrated that OSTC affects retrotranslocation efficiency, providing functional evidence for its role in ERAD beyond simple physical interactions.

How can researchers differentiate between OSTC's roles in N-glycosylation versus ERAD functions in experimental settings?

Differentiating between OSTC's dual roles requires carefully designed experimental approaches that can temporally separate these functions. One effective strategy involves using puromycin treatment to release nascent chains from ribosomes, thereby preventing new protein synthesis and forward translocation while allowing analysis of ERAD processes . This approach, combined with proteasome inhibitors such as MG132, can isolate OSTC's ERAD-associated functions from its cotranslational glycosylation activity.

A comprehensive experimental workflow to distinguish these roles includes:

Experimental ConditionPurposeExpected Outcome
Normal conditionsBaseline measurementOSTC associated with both translocation and ERAD
Puromycin treatmentBlock new translationEnrichment of OSTC in ERAD complexes
Proteasome inhibitionAccumulate ERAD substratesIncreased detection of OSTC with ERAD substrates
Combined puromycin + proteasome inhibitionIsolate post-translational ERADMaximal detection of OSTC-ERAD associations
Tunicamycin treatmentBlock glycosylationTest ERAD function independent of glycosylation

Research has demonstrated that OSTC and other OST subunits (STT3A, MAGT1) associate with ERAD substrates specifically after proteasome inhibition, and this association occurs after the substrate has been fully glycosylated . This temporal separation provides a window for distinguishing between the initial glycosylation function and the later ERAD-associated activities.

What are the optimal experimental designs for studying OSTC's impact on retrotranslocation efficiency?

An optimal experimental design for studying OSTC's impact on retrotranslocation utilizes the BioID proximity labeling system coupled with controlled manipulation of OSTC expression. Research has shown that this approach can quantitatively measure retrotranslocation efficiency by detecting the biotinylation of cytosolically-exposed portions of ERAD substrates .

A comprehensive experimental design would include:

  • Generation of an ERAD substrate with a C-terminal biotin acceptor peptide (BAP) tag (e.g., H2a-BAP)

  • Co-expression with cytosolic biotin ligase (BirA) to biotinylate BAP tags only after retrotranslocation

  • Parallel experimental conditions:

    • Control (normal OSTC levels)

    • OSTC overexpression (via GFP-OSTC)

    • OSTC knockdown (via siRNA)

  • Proteasome inhibition to accumulate retrotranslocated but not yet degraded substrate

  • Quantification of:

    • Total substrate levels (by immunoblotting)

    • Biotinylated (retrotranslocated) substrate (by streptavidin pulldown)

    • Calculation of retrotranslocation ratio (biotinylated/total)

Research has demonstrated that OST subunit overexpression significantly increases the retrotranslocation ratio of ERAD substrates, while knockdown decreases this ratio . For instance, GFP-DAD1 overexpression caused a substantial increase in the proportion of retrotranslocated H2a-BAP relative to total H2a-BAP, compared to control conditions. This provides a quantitative measure of OSTC's functional contribution to the ERAD process.

How should researchers address experimental variability when measuring OSTC-dependent effects on ERAD substrate degradation?

Addressing experimental variability in OSTC-dependent ERAD studies requires implementation of risk-adaptive experimental design principles. Drawing from methodologies developed for high-consequence systems research, investigators should incorporate strategies that specifically target distribution tails and enhance reproducibility .

A methodologically robust approach includes:

  • Implementation of optimality criteria that shape the distribution of prediction variances

  • Development of risk-adapted surrogate models that provably overestimate critical statistics

  • Utilization of regression approaches targeting tail statistics such as superquantile regression

  • Employment of appropriate controls for all experimental variables:

    • Multiple ERAD substrates with different topologies (type I, type II transmembrane, and soluble luminal)

    • Different OST subunit manipulations (e.g., OSTC, DAD1, Tusc3)

    • Time-course measurements to capture kinetic differences

Research has demonstrated substantial variability in the effects of OST subunit manipulations depending on the specific ERAD substrate . For example, DAD1 or Tusc3 knockdown caused accumulation of BACE476 and NHK, but the effect was less pronounced than for H2a. These substrate-dependent differences must be systematically characterized using statistical approaches that can account for this inherent variability.

What are the current methodological limitations in studying OSTC-HRD1 interactions and how can they be overcome?

Current methodological limitations in studying OSTC-HRD1 interactions include challenges in preserving native membrane protein complexes, difficulty in distinguishing direct from indirect interactions, and limitations in temporal resolution of dynamic complex formation. Research indicates that these interactions may be transient and highly regulated, particularly during proteasomal inhibition when both proteins accumulate but their interaction ratio decreases .

To overcome these limitations, researchers should implement:

  • Advanced membrane protein crosslinking approaches:

    • Photo-activatable crosslinkers for temporally controlled interaction capture

    • Site-specific crosslinkers to map interaction domains

    • MS-compatible crosslinkers for comprehensive interactome analysis

  • Live-cell imaging techniques:

    • FRET-based assays to monitor OSTC-HRD1 interactions in real-time

    • Single-molecule tracking to characterize interaction dynamics

    • Correlative light-electron microscopy to visualize interaction microdomains

  • Single-case experimental designs (SCEDs):

    • Implementation of experimental paradigms that evaluate functional relationships at the individual cell level

    • Repeated measures under various conditions to establish causality

    • Statistical analysis approaches specifically designed for single-case experimental data

Research has demonstrated that while gross coimmunoprecipitation experiments can detect OSTC-HRD1 interactions, the ratio of interacting proteins changes dramatically under different conditions, suggesting complex regulatory mechanisms . Implementing these advanced methodologies can provide deeper insights into the spatial, temporal, and functional aspects of these critical protein interactions.

How does OSTC contribute to the specialized degradation pathways for different classes of ERAD substrates?

OSTC shows substrate selectivity in its ERAD functions, with differential effects depending on protein topology and folding defects. Research demonstrates that while OSTC promotes degradation of various ERAD substrates, the magnitude of this effect varies significantly across substrate classes . For type I transmembrane proteins like H2a, OSTC appears to play a more prominent role compared to its effects on type II transmembrane proteins (BACE476) or soluble luminal substrates (NHK).

A comprehensive analysis of OSTC's contribution across substrate classes reveals:

ERAD Substrate TypeExampleOSTC Effect MagnitudePrimary Mechanism
Type I transmembraneH2aStrongDirect promotion of retrotranslocation
Type II transmembraneBACE476ModerateInteraction with HRD1 complex
Soluble luminalNHKModerateMembrane distortion facilitating extraction
Glycosylated substratesH2a (WT)StrongRecognition of glycan structures
Non-glycosylated substratesH2a (mutant)WeakerGlycan-independent mechanisms

Mechanistically, OSTC appears to function at the interface between substrate recognition and the retrotranslocation machinery. For glycosylated substrates, OSTC likely recognizes specific glycan structures that serve as degradation signals, while also contributing more directly to the physical process of retrotranslocation through its multiple transmembrane domains that may facilitate membrane distortion .

What experimental approaches can reveal the structural basis for OSTC's dual functionality in glycosylation and ERAD?

A comprehensive experimental approach should include:

  • Cryo-electron microscopy:

    • Analysis of OST complexes under normal conditions versus ERAD-inducing conditions

    • Comparison of OSTC conformations in different functional states

    • Structural determination of OSTC-HRD1 interaction interfaces

  • Cross-linking mass spectrometry:

    • Identification of OSTC residues in proximity to ERAD machinery components

    • Mapping of conformational changes during transition between functions

    • Characterization of interaction networks under different cellular conditions

  • Site-directed mutagenesis guided by structural predictions:

    • Generation of OSTC variants with mutations in putative functional domains

    • Functional testing in glycosylation versus ERAD assays

    • Identification of residues critical for specific functions

  • Molecular dynamics simulations:

    • Modeling of OSTC within lipid bilayers to predict membrane distortion effects

    • Simulation of OSTC-substrate interactions during different phases of processing

    • Prediction of conformational changes associated with functional transitions

Research suggests that OSTC may participate in membrane distortion, similar to the mechanism proposed for the HRD1-Der1 interface in yeast . This structural role could be crucial for creating an environment conducive to the physical extraction of misfolded proteins from the ER membrane during retrotranslocation.

How can advanced statistical methods improve the analysis of OSTC's variable effects across different experimental systems?

Advanced statistical methods, particularly those developed for analyzing individual variability within experimental systems, can significantly improve our understanding of OSTC's context-dependent functions. Recent developments in single-case experimental design (SCED) methodologies provide robust frameworks for analyzing OSTC effects across variable experimental conditions .

Recommended statistical approaches include:

  • Multilevel modeling for synthesizing data across diverse experimental systems:

    • Accounting for substrate-specific, cell type-specific, and condition-specific variance

    • Quantifying interaction effects between OSTC and other factors

    • Estimating random effects to characterize experimental system heterogeneity

  • Risk-adaptive experimental design targeting distribution tails:

    • Development of optimality criteria to shape prediction variance distributions

    • Implementation of risk-adapted surrogate models to estimate upper bounds of effects

    • Application of superquantile regression approaches for tail statistics

  • Visual and statistical analysis innovations for repeated measures:

    • Implementation of methodologies to examine effect sizes across conditions

    • Strategies for handling missing values in time-series experimental data

    • Meta-analytical approaches for summarizing data from multiple experiments

By applying these advanced statistical methodologies, researchers can more accurately characterize the functional heterogeneity observed in OSTC studies. For example, research has shown that OSTC effects on ERAD vary not only by substrate but also by experimental condition, with particularly strong effects observed under proteasomal inhibition . These nuanced effects require sophisticated statistical approaches to fully characterize.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.