Recombinant Human Opalin (OPALIN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OPALIN; HTMP10; TMEM10; Opalin; Oligodendrocytic myelin paranodal and inner loop protein; Transmembrane protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OPALIN
Target Protein Sequence
MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE
Uniprot No.

Target Background

Function

Recombinant Human Opalin (OPALIN) is a central nervous system-specific myelin protein that enhances myelin gene expression during oligodendrocyte differentiation and promotes their terminal differentiation.

Gene References Into Functions
  1. Highly sialylglycosylated Opalin plays a crucial intermembranous role within the myelin paranodal loops of the central nervous system. PMID: 18490449
Database Links

HGNC: 20707

KEGG: hsa:93377

STRING: 9606.ENSP00000360214

UniGene: Hs.12449

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Brain specific; expressed in oligodendrocytes. Expressed in oligodendrocytes in remyelinating multiple sclerosis plaques.

Q&A

What is Human Opalin and what is its molecular structure?

Human Opalin, also known as TMEM10 (Transmembrane Protein 10), is a transmembrane sialylglycoprotein specifically expressed in mammalian oligodendrocytes that plays a significant role in oligodendrocyte differentiation and myelination . Based on structural analysis, Opalin consists of three distinct domains: a short N-terminal extracellular domain (amino acids 1-30), a transmembrane domain (amino acids 31-53), and a longer C-terminal intracellular domain (amino acids 54-143) . The protein has a calculated molecular mass of approximately 15,833 Da and an isoelectric point (pI) of 4.88 .

For recombinant expression, the human OPALIN sequence encoding Thr51-Glu141 is commonly used, often expressed with an Fc tag to facilitate purification and detection .

Where is Opalin expressed in the central nervous system?

Opalin expression is highly specific to the central nervous system (CNS) and is not detected in the peripheral nervous system (PNS) . Within the CNS, it is expressed exclusively by oligodendrocytes, which are the myelinating cells responsible for forming the insulating myelin sheath around axons.

At the subcellular level, Opalin demonstrates a distinctive localization pattern:

  • Present in oligodendrocyte cell bodies (somata)

  • Distributed throughout oligodendrocyte processes

  • Found in myelinated axons in a spiral pattern

  • Highly concentrated in the paranodal loop regions of myelin

Immunogold electron microscopy has confirmed that Opalin is specifically localized at particular sites in the paranodal loop membrane, suggesting a specialized function in these regions .

What are the key functional domains of Opalin?

Opalin contains several important functional domains that contribute to its role in oligodendrocyte biology:

  • N-terminal extracellular domain (amino acids 1-30):

    • Contains two N-linked glycosylation consensus sites (Asn-6 and Asn-12)

    • Critical for proper cell surface localization

    • Involved in potential intermembrane interactions

  • Transmembrane domain (amino acids 31-53):

    • Anchors the protein within the oligodendrocyte membrane

    • May facilitate protein-protein interactions within the lipid bilayer

  • C-terminal intracellular domain (amino acids 54-143):

    • Contains six consensus sites for protein phosphorylation

    • Likely mediates intracellular signaling pathways

    • Potentially interacts with cytoplasmic proteins in oligodendrocytes

Functional studies using site-directed mutagenesis have demonstrated that modifications to these domains, particularly the glycosylation sites, significantly impair proper protein localization and function .

What expression systems are most effective for producing recombinant human Opalin?

For successful expression of recombinant human Opalin, researchers typically employ mammalian expression systems to ensure proper post-translational modifications, particularly glycosylation. The methodological approach includes:

  • Expression Host Selection:

    • Human cell lines (such as HEK293) are preferred for recombinant human Opalin production

    • These systems ensure proper folding and post-translational modifications

  • Expression Vector Design:

    • DNA sequence encoding human OPALIN (Q96PE5-2) (Thr51-Glu141) is commonly used

    • Fusion with the Fc region of mouse IgG1 at the N-terminus facilitates purification

    • Vectors should contain strong promoters (CMV) and appropriate selection markers

  • Transfection and Selection:

    • Transfection can be performed using lipid-based reagents or electroporation

    • Stable cell lines should be established through antibiotic selection

    • Clone screening ensures high expression levels and proper protein folding

The expressed recombinant protein should be verified through Western blotting, mass spectrometry, and functional assays to confirm its identity and biological activity.

How can glycosylation of Opalin be analyzed in experimental settings?

Glycosylation analysis of Opalin is critical given that both N-linked and O-linked glycans contribute significantly to its function. Methodological approaches include:

  • Enzymatic Deglycosylation Analysis:

    • Treatment with PNGase F to remove N-linked glycans

    • Treatment with O-glycosidase to remove O-linked glycans

    • Neuraminidase treatment to remove sialic acids

    • Analysis of mobility shifts via SDS-PAGE before and after treatment

  • Site-Directed Mutagenesis:

    • Generation of constructs with mutations at predicted glycosylation sites (Asn-6, Asn-12)

    • Expression in cell culture systems

    • Assessment of localization using immunofluorescence microscopy

    • Comparison of molecular weight and function to wild-type protein

  • Mass Spectrometry Analysis:

    • Tryptic digestion of purified Opalin

    • MALDI-TOF or LC-MS/MS analysis

    • Identification of glycopeptides and glycan structures

    • Quantification of site occupancy at each glycosylation site

These methods provide complementary information about the types, positions, and functional significance of glycans on Opalin.

What signaling pathways regulate Opalin expression in oligodendrocytes?

Several signaling pathways have been identified that regulate Opalin expression, providing targets for experimental manipulation:

Signaling PathwayEffect on OpalinExperimental Approach
LIF SignalingEnhances expressionTreatment of Oli-neu cells with LIF; Monitor expression via qPCR/Western blot
cAMP CascadeActivates Opalin enhancerApplication of cAMP analogs; CREB activation analysis
Myt1 Transcription FactorIncreases endogenous OpalinOverexpression of Myt1; ChIP to confirm binding to Opalin promoter

Research has demonstrated that these pathways act on the Opalin oligodendrocyte enhancer, suggesting that Opalin regulation is integrated within broader oligodendrocyte differentiation programs . Experimental designs targeting these pathways should incorporate time-course analyses to capture the dynamic regulation of Opalin expression during differentiation.

How can researchers study Opalin's role in paranodal loop formation and function?

To investigate Opalin's specific function in paranodal loops, researchers can employ these methodological approaches:

  • High-Resolution Localization Studies:

    • Immunogold electron microscopy using anti-Opalin antibodies

    • Super-resolution microscopy (STORM, PALM) of fluorescently tagged Opalin

    • Co-localization with other paranodal proteins (Caspr, Nfasc155)

  • Functional Manipulation:

    • CRISPR/Cas9-mediated knockout in oligodendrocyte precursor cells

    • Conditional knockout mouse models (Opalin-flox × CNP-Cre)

    • Expression of dominant-negative constructs

  • Analysis of Paranodal Architecture:

    • Transmission electron microscopy of paranodal regions

    • Freeze-fracture electron microscopy to visualize membrane specializations

    • Assessment of transverse bands and septate-like junctions

  • Electrophysiological Assessments:

    • Compound action potential recordings in normal vs. Opalin-deficient nerves

    • Analysis of saltatory conduction velocity

    • Assessment of paranodal junction integrity through K+ channel clustering

These approaches allow for comprehensive assessment of Opalin's functional contribution to the highly specialized paranodal regions critical for proper nerve conduction.

What are common challenges in detecting endogenous Opalin expression?

Researchers often encounter several challenges when attempting to detect endogenous Opalin:

  • Antibody Specificity Issues:

    • Solution: Validate antibodies using Opalin knockout tissues as negative controls

    • Use multiple antibodies targeting different epitopes

    • Confirm specificity through immunoprecipitation followed by mass spectrometry

  • Low Expression Levels:

    • Solution: Enrich for white matter tissue before protein extraction

    • Use more sensitive detection methods (chemiluminescence, fluorescence)

    • Consider amplification steps for immunohistochemistry

  • Protein Degradation:

    • Solution: Process samples rapidly and maintain cold temperatures

    • Include protease inhibitors in all buffers

    • Consider acidification of samples to pH 2.5 to improve stability (similar to approaches used for other peptides)

  • Post-translational Modifications:

    • Solution: Use deglycosylation treatments to confirm band identity

    • Run parallel samples with and without dephosphorylation

    • Consider enrichment methods for glycoproteins

How can researchers optimize co-culture systems to study Opalin in myelination?

To effectively study Opalin's role in myelination using co-culture systems:

  • Cell Source Selection:

    • Primary rat dorsal root ganglion neurons with primary rat oligodendrocyte precursor cells

    • Mouse cortical neurons with mouse oligodendrocyte precursors

    • Human iPSC-derived neurons and oligodendrocytes for human-specific studies

  • Timeline Optimization:

    • Allow neurons to extend neurites for 7-10 days before adding oligodendrocytes

    • Monitor Opalin expression from day 3-21 after oligodendrocyte addition

    • Collect time points corresponding to different stages of myelination

  • Analytical Methods:

    • Immunofluorescence for Opalin and myelin markers (MBP, PLP)

    • Live imaging using fluorescently tagged Opalin constructs

    • Electron microscopy to assess myelin ultrastructure

  • Manipulation Approaches:

    • Lentiviral delivery of Opalin shRNA or overexpression constructs

    • Addition of soluble factors that affect pathways regulating Opalin (LIF, cAMP analogs)

    • Application of Opalin-blocking antibodies to disrupt function

What are the emerging hypotheses about Opalin's evolutionary significance?

Opalin homologues are present only in mammals, suggesting it evolved relatively recently and may contribute to specialized aspects of mammalian myelin . Promising research directions include:

  • Comparative Genomics:

    • Sequence comparison across mammalian lineages

    • Identification of conserved regulatory elements

    • Analysis of selection pressure on different protein domains

  • Functional Divergence:

    • Comparison of Opalin localization in different mammalian species

    • Cross-species complementation experiments

    • Assessment of species-specific protein interactions

  • Relationship to Myelination Efficiency:

    • Correlation between Opalin expression and conduction velocity

    • Comparison with non-mammalian myelination mechanisms

    • Potential role in specialized mammalian brain functions

This evolutionary perspective may provide insights into Opalin's contribution to the enhanced complexity of mammalian nervous systems.

What potential therapeutic applications might emerge from Opalin research?

Understanding Opalin's function in myelination opens several avenues for therapeutic exploration:

  • Demyelinating Disorders:

    • Examination of Opalin expression in multiple sclerosis lesions

    • Assessment as a potential biomarker for remyelination capacity

    • Target for promoting oligodendrocyte differentiation and remyelination

  • Developmental Myelination Disorders:

    • Analysis of Opalin mutations or expression changes in leukodystrophies

    • Potential gene therapy approaches for Opalin-related pathologies

    • Development of small molecules targeting Opalin-regulated pathways

  • Enhancing Myelination After Injury:

    • Manipulation of Opalin expression to promote remyelination after trauma

    • Assessment in models of spinal cord injury

    • Combined approaches targeting Opalin alongside other pro-myelinating factors

These therapeutic directions require further fundamental research but represent promising applications of Opalin biology to clinical challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.