Recombinant Human Opsin-3 (OPN3)-VLPs

Shipped with Ice Packs
In Stock

Description

Understanding OPN3 and VLPs

Opsin-3 (OPN3)
OPN3 is a non-visual opsin protein that functions as a light-sensitive G protein-coupled receptor (GPCR). Key characteristics include:

PropertyDetails
ExpressionBrain, testis, skin, liver, pancreas, heart, lung, skeletal muscle
FunctionUV/blue light sensing; regulates melanogenesis, phototransduction, and energy balance
Structural Features7 transmembrane domains; binds retinal chromophores

Virus-Like Particles (VLPs)
VLPs are non-infectious, genome-free structures mimicking viral capsids. They are used as vaccine candidates or delivery systems. Key examples include poliovirus (PV) VLPs, which lack viral RNA but retain antigenic properties .

Potential Connections Between OPN3 and VLPs

While no direct studies on OPN3-VLPs exist, the following connections can be hypothesized:

OPN3 as a Payload in VLPs

VLPs are often engineered to display heterologous proteins. If OPN3 were incorporated into VLPs, it might serve as a:

  • Light-responsive cargo: Leveraging OPN3’s phototransduction properties for targeted delivery or optogenetic applications.

  • Therapeutic agent: For conditions linked to OPN3 dysfunction, such as melanogenesis disorders or metabolic regulation .

OPN3-Expressing Cells for VLP Production

OPN3 is expressed in mammalian cells (e.g., HEK-293) for recombinant protein production . While VLPs are typically produced via co-expression of viral capsid proteins and proteases (e.g., PV P1 and 3CD ), OPN3’s expression in these systems could theoretically be explored for dual-purpose applications (e.g., light-responsive VLPs).

Research Gaps and Challenges

AspectDetails
Expression SystemsOPN3 is recombinantly produced in mammalian cells (e.g., HEK-293) , but VLP production requires viral capsid proteins (e.g., PV P1) . No overlap in current literature.
Functional RelevanceOPN3’s role in phototransduction does not align with VLPs’ primary use as antigen-presenting platforms.
Structural CompatibilityOPN3’s GPCR structure differs from viral capsid proteins, making integration into VLPs technically unexplored.

OPN3 in Phototransduction and Skin Health

  • UV-induced signaling: OPN3 mediates UVA-induced MMP expression in dermal fibroblasts via calcium-dependent GPCR pathways .

  • Melanogenesis regulation: OPN3 interacts with tyrosinase-related proteins to modulate melanin synthesis under blue light .

VLP Production for Vaccines

  • Poliovirus VLPs: Stabilized PV3 VLPs, produced in mammalian cells (BHK-21), induce neutralizing antibodies comparable to inactivated polio vaccine (IPV) .

  • Mammalian expression advantages: Native lipidic pocket factors in PV VLPs enhance structural authenticity and immunogenicity .

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance as extra fees will be charged for dry ice and dry ice box.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it and ensure to avoid repeated freezing and thawing to prevent impact on protein activity.
Shelf Life
The shelf life is dependent on various factors, including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you require a specific tag type, please inform us and we will verify its feasibility for development.
Synonyms
OPN3; ECPN; Opsin-3; Encephalopsin; Panopsin
Datasheet & Coa
Please contact us to get it.
Expression Region
1-402aa
Research Area
Neuroscience
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Opsin-3 (OPN3) is a G-protein coupled receptor that selectively activates G proteins through ultraviolet A (UVA) light-mediated activation in the skin. It binds both 11-cis retinal and all-trans retinal. OPN3 regulates melanogenesis in melanocytes by inhibiting alpha-MSH-induced MC1R-mediated cAMP signaling, modulating calcium flux, regulating CAMK2 phosphorylation, and subsequently phosphorylating CREB, p38, ERK and MITF in response to blue light. It plays a role in melanocyte survival by regulating intracellular calcium levels and subsequent BCL2/RAF1 signaling. Additionally, it regulates apoptosis through cytochrome c release and subsequent activation of the caspase cascade. OPN3 is required for TYR and DCT blue light-induced complex formation in melanocytes. It is involved in keratinocyte differentiation in response to blue light. OPN3 is required for the UVA-mediated induction of calcium and mitogen-activated protein kinase signaling resulting in the expression of MMP1, MMP2, MMP3, MMP9 and TIMP1 in dermal fibroblasts. It plays a role in light-mediated glucose uptake, mitochondrial respiration and fatty acid metabolism in brown adipocyte tissues. OPN3 may be involved in photorelaxation of airway smooth muscle cells, via blue-light dependent GPCR signaling pathways.
Gene References Into Functions
  1. Reduced OPN3 levels in Bel7402(5-FU) cells activated the anti-apoptotic pathway by increasing phospho-Akt and the Bcl2/Bax ratio, while overexpression of OPN3 inactivated this pathway. PMID: 22313545
  2. OPN3 (panopsin) has been assigned to human chromosome band 1q43. PMID: 12063405
  3. The human OPN3 gene comprises six exons and expresses various splice variants. PMID: 12242008
  4. Polymorphisms in the OPN3 and CHML genes are associated with asthma and atopic asthma. PMID: 18344558
  5. Individuals with heterozygous germline deletions of 1q42.3, encompassing EXO1, RGS7, KMO, CHML, and OPN3, exhibited no phenotypic abnormalities apart from multiple leiomyomatosis. PMID: 14623461

Show More

Hide All

Database Links

HGNC: 14007

OMIM: 606695

KEGG: hsa:23596

STRING: 9606.ENSP00000355512

UniGene: Hs.409081

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in tracheal airway smooth muscle (at protein level). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level). Expressed in dermal fibroblasts (at protein level). Express

Q&A

What are Recombinant Human OPN3-VLPs and how do they differ from native OPN3?

Recombinant Human OPN3-VLPs are engineered virus-like particles that display human Opsin-3 proteins in a structured manner. Unlike native OPN3, which functions as a transmembrane G-protein coupled receptor embedded in cellular membranes, OPN3-VLPs present the protein in a multivalent display on non-infectious particles that mimic viral architecture without containing viral genetic material. This structural organization potentially offers enhanced stability and standardized presentation of the receptor, making it valuable for research applications. The concept builds on established VLP technology, such as that used for poliovirus vaccines, where recombinant expression systems produce empty capsid-like structures . Native OPN3 functions as a light-sensitive receptor that activates Gi/Go-type G proteins in response to blue-green light, regulating signaling cascades that ultimately affect neuronal firing and physiological processes .

Which expression systems are optimal for producing functional OPN3-VLPs?

Based on research with similar proteins and VLP systems, both mammalian and yeast expression systems have demonstrated effectiveness for producing functional recombinant particles:

Mammalian expression systems: HEK293 cells have successfully expressed functional OPN3 with proper post-translational modifications . For VLP production, mammalian systems provide appropriate cellular machinery for protein folding and incorporation of essential cofactors. Research with poliovirus VLPs showed that mammalian expression yields particles with stabilizing lipidic pocket-factors in the VP1 β-barrel, which may have parallels in OPN3 stability .

Yeast expression systems: Pichia pastoris has proven effective for producing poliovirus VLPs in native conformation with good yields . This system offers advantages in scalability and cost-effectiveness, though additional optimization may be needed to ensure proper OPN3 folding and retinal incorporation.

The choice depends on research priorities, with mammalian systems favored when native conformation and functional validation are critical, and yeast systems preferred when higher yield and scalability are paramount.

How can researchers verify OPN3 light-sensitivity when incorporated into VLPs?

Verification of OPN3 light-sensitivity in VLPs requires multiple complementary approaches:

  • Spectroscopic analysis: Functional OPN3-VLPs should demonstrate characteristic spectral shifts upon light exposure, with absorption maxima in the blue-green region (~470-500nm) . These shifts indicate proper protein folding and retinal cofactor incorporation.

  • G-protein activation assays: Since OPN3 activates Gi/Go-type G proteins, researchers should measure light-dependent changes in G-protein activity using GTP binding assays or downstream cAMP measurements. In properly formed OPN3-VLPs, blue light exposure should trigger measurable decreases in intracellular cAMP concentration through inhibition of adenylyl cyclase .

  • Retinal binding assessment: OPN3 function requires binding to retinal cofactors. Successful binding can be verified through spectroscopic features or through extraction and HPLC analysis. Importantly, OPN3 can utilize both 11-cis and 13-cis retinal, with the latter offering advantages due to its thermal equilibrium with all-trans retinal .

The bistable nature of OPN3 (ability to repeatedly respond to light without bleaching) represents a key functional characteristic that should be preserved in properly formed OPN3-VLPs .

What strategies can enhance the stability and functionality of OPN3-VLPs for neuronal studies?

Enhancing OPN3-VLP stability for neuronal applications requires multifaceted approaches:

  • Thermal and conformational stabilization:

    • Implement targeted mutations similar to those used for poliovirus VLPs, which substantially improved thermostability compared to conventional vaccines

    • Engineer disulfide bonds to lock OPN3 in its active conformation

    • Identify and incorporate pocket-binding compounds that enhance protein stability

  • Retinal cofactor stabilization:

    • Optimize conditions to prevent retinal isomerization or dissociation

    • Explore OPN3's compatibility with 13-cis retinal, which offers greater stability than 11-cis retinal

    • Develop encapsulation methods to protect the chromophore from degradation

  • Particle integrity enhancement:

    • Apply gentle crosslinking techniques that preserve biological activity

    • Optimize buffer conditions with stabilizing agents

    • Develop surface modification strategies to reduce aggregation

  • Functional preservation methods:

    • Determine optimal storage conditions (temperature, light protection, additives)

    • Establish accelerated stability testing protocols to predict long-term functionality

    • Implement regular quality control testing for light responsiveness

Researchers should employ differential scanning calorimetry to quantify thermal stability improvements and use functional G-protein activation assays to confirm preserved light sensitivity after stabilization procedures .

How can researchers investigate OPN3-VLP interactions with the MC4R signaling pathway in hypothalamic neurons?

Recent discoveries have revealed that OPN3 functionally interacts with the melanocortin 4 receptor (MC4R) pathway in hypothalamic neurons to regulate food intake . Investigating this interaction with OPN3-VLPs requires sophisticated experimental approaches:

  • Biochemical interaction studies:

    • Co-immunoprecipitation assays to detect physical associations between OPN3-VLPs and MC4R

    • FRET-based proximity assays in living cells expressing MC4R

    • Surface plasmon resonance to quantify binding kinetics

  • Functional signaling analysis:

    • Measure effects of OPN3-VLP activation on MC4R-mediated signaling, particularly focusing on:

      • Potassium channel (Kir7.1) activity, a key component of this pathway

      • Changes in neuronal firing rates in hypothalamic neurons expressing MC4R

      • Alterations in cAMP levels under different light conditions

  • In vitro neuronal models:

    • Primary hypothalamic neuronal cultures exposed to OPN3-VLPs

    • Designer cells co-expressing MC4R and downstream signaling components

    • Ex vivo slice preparations from hypothalamus

  • Systematic experimental design:

Experimental ConditionLight StatusMC4R LigandMeasured Outcome
OPN3-VLPs onlyDarkNoneBaseline signaling
OPN3-VLPs onlyBlue lightNoneOPN3-mediated effects
OPN3-VLPs + MC4RDarkα-MSHMC4R activation baseline
OPN3-VLPs + MC4RBlue lightα-MSHCombined pathway effects
Control VLPs + MC4REither conditionα-MSHControl for VLP effects

This approach would help determine whether OPN3-VLPs can modulate the MC4R pathway similar to native OPN3, potentially offering new tools for controlling feeding behavior through optogenetic means .

What are the technical challenges in ensuring proper orientation of OPN3 on VLPs?

Ensuring proper orientation of OPN3 on VLPs presents significant technical challenges requiring specialized approaches:

  • Structural verification methods:

    • Cryo-electron microscopy to visualize OPN3 incorporation and orientation

    • Epitope mapping with domain-specific antibodies that distinguish between correctly and incorrectly oriented protein

    • Accessible surface labeling with membrane-impermeable probes

  • Functional validation approaches:

    • Orientation-dependent G-protein activation assays

    • Protease protection assays to confirm topology

    • Light-dependent conformational change detection

  • Engineering solutions:

    • Design fusion constructs with orientation-directing domains

    • Implement transmembrane anchoring strategies optimized for VLP display

    • Utilize binding partners that facilitate correct insertion

  • Quality control methodologies:

    • Develop quantitative assays for the proportion of correctly oriented protein

    • Implement enrichment techniques to select properly oriented populations

    • Establish criteria for minimum functional activity thresholds

Researchers should combine multiple approaches, as no single method can definitively confirm proper orientation across heterogeneous VLP populations. The transmembrane nature of OPN3 adds complexity compared to soluble proteins displayed on VLPs .

What purification protocol best maintains OPN3-VLP functional integrity?

Purification of OPN3-VLPs requires specialized procedures to preserve both structural integrity and light sensitivity:

  • Initial processing:

    • For mammalian expression: Harvest cells 48-72 hours post-transfection

    • For yeast expression: Harvest at optimal time point determined empirically

    • Use gentle lysis methods under red light conditions to protect the retinal chromophore

    • Incorporate protease inhibitors to prevent degradation

  • Primary purification:

    • Clarify lysate through low-speed centrifugation and filtration

    • Implement density gradient ultracentrifugation (sucrose or iodixanol)

    • Maintain temperature control throughout (typically 4°C)

    • Consider addition of stabilizing agents that preserve OPN3 conformation

  • Secondary purification:

    • Size exclusion chromatography to separate VLPs from aggregates and protein debris

    • Consider affinity-based approaches if tags are incorporated

    • Ion exchange chromatography for final polishing if charge characteristics are suitable

  • Quality control:

    • Dynamic light scattering to confirm particle size uniformity

    • Negative stain TEM to verify particle morphology

    • Spectroscopic analysis to confirm retinal incorporation and light responsiveness

    • G-protein activation assays to verify functionality

Throughout purification, minimize exposure to blue/white light, avoid detergents that might disrupt the lipid environment required for OPN3 stability, and implement rapid processing to preserve functional integrity .

How can researchers accurately quantify functional OPN3 molecules per VLP?

Accurate quantification of functional OPN3 molecules per VLP requires multiple complementary approaches:

  • Protein-based quantification:

    • Total protein assays (BCA/Bradford) correlated with particle counts

    • SDS-PAGE with densitometry against OPN3 standards

    • Mass spectrometry-based absolute quantification using isotope-labeled peptides

  • Functional quantification:

    • Light-dependent G-protein activation per VLP

    • Retinal binding capacity measurements

    • Antibody binding assays with conformation-specific antibodies

  • Direct visualization methods:

    • Single-molecule fluorescence with labeled antibodies

    • Cryo-EM structural analysis with computational counting

    • Super-resolution microscopy with appropriate tags

  • Comparative analysis framework:

Quantification MethodAdvantagesLimitationsResolution
Mass SpectrometryHigh specificity, absolute quantificationComplex sample preparationHigh
Fluorescence-basedDirect visualization, spatial distributionRequires labelingMedium-High
Cryo-EMStructural context, no labeling neededSpecialized equipment requiredHigh
Functional assaysMeasures only active proteinIndirect measurementMedium

By combining these approaches, researchers can determine both the total and functionally active OPN3 molecules per VLP, essential information for standardizing experimental preparations and interpreting results .

What light stimulation parameters are optimal for activating OPN3-VLPs in experimental settings?

Determining optimal light stimulation parameters requires systematic characterization of OPN3-VLP photosensitivity:

  • Spectral sensitivity profiling:

    • Measure action spectrum across wavelengths (typically peaks in blue-green region, 470-500nm)

    • Determine minimum effective wavelength bands

    • Assess off-target activation at different wavelengths

  • Intensity requirements:

    • Establish dose-response relationships for light intensity

    • Determine threshold intensity for activation

    • Measure saturation points where higher intensity yields no additional response

  • Temporal dynamics:

    • Characterize activation kinetics (typical response times)

    • Determine deactivation rates after light termination

    • Assess potential for photocycle-dependent adaptation

  • Practical implementation guidance:

    • For in vitro studies: LED sources with appropriate filters and power control

    • For cellular studies: Consider light scattering and absorption by media

    • For tissue studies: Account for light penetration limitations

  • Optimization framework:

ParameterTypical RangeMeasurement MethodConsiderations
Wavelength470-500nmAction spectrumFilter selection, specificity
Intensity0.1-10 mW/mm²Power meterTissue penetration, heating
Pulse duration1ms-continuousOscilloscopePhotocycle kinetics
Frequency0.1-20 HzProgrammed stimulatorResponse recovery time

Researchers should systematically test these parameters to create standardized protocols that reliably activate OPN3-VLPs while minimizing phototoxicity or unintended effects on experimental systems .

How can OPN3-VLPs be utilized for studying hypothalamic circuits involved in feeding behavior?

The recent discovery that OPN3 regulates food consumption via the MC4R pathway opens significant opportunities for using OPN3-VLPs to study hypothalamic feeding circuits:

  • Advantages of OPN3-VLPs for hypothalamic research:

    • Non-genetic approach to manipulate Gi/Go signaling in MC4R neurons

    • Potential for region-specific delivery without viral vectors

    • Compatibility with existing electrophysiological and imaging techniques

    • Temporally precise control through light stimulation

  • Experimental paradigms:

    • Ex vivo brain slice preparations with targeted OPN3-VLP application

    • Microinjection of OPN3-VLPs into specific hypothalamic nuclei in vivo

    • Combined electrophysiology and optogenetic stimulation

    • Behavioral studies with implanted light delivery systems

  • Specific research questions addressable with OPN3-VLPs:

    • Temporal dynamics of MC4R modulation on feeding behavior

    • Circuit-level effects of Gi/Go activation in hypothalamic neurons

    • Interaction between OPN3 signaling and other feeding-related pathways

    • Potential compensatory mechanisms in feeding regulation

  • Methodological approach:

    • Target paraventricular hypothalamic neurons expressing MC4R

    • Combine OPN3-VLP application with electrophysiological recording

    • Monitor potassium channel (Kir7.1) activity as a readout of pathway activation

    • Correlate neuronal activity changes with feeding behavior

This approach leverages OPN3's natural role in hypothalamic signaling to develop tools for precise manipulation of feeding circuits, potentially leading to new insights into obesity and eating disorders .

What experimental designs best evaluate OPN3-VLP efficacy for optogenetic applications?

Evaluating OPN3-VLPs for optogenetic applications requires comprehensive experimental designs that address both technical performance and biological relevance:

  • In vitro validation framework:

    • Cell-based assays comparing OPN3-VLPs to conventional optogenetic tools

    • Quantification of signal-to-noise ratio in activation responses

    • Determination of temporal resolution (on/off kinetics)

    • Assessment of repeated activation capacity without desensitization

  • Ex vivo functional testing:

    • Brain slice preparations with targeted OPN3-VLP application

    • Multi-electrode array recordings to capture network effects

    • Calcium imaging to visualize spatial spread of activation

    • Pharmacological manipulation to confirm signaling mechanisms

  • In vivo evaluation protocol:

    • Stereotactic delivery of OPN3-VLPs to specific brain regions

    • Implantation of optical fibers or wireless light delivery systems

    • Electrophysiological recording during light stimulation

    • Behavioral assessment during controlled light activation

  • Comparative analysis with established techniques:

FeatureOPN3-VLPsViral OptogeneticsPharmacogeneticsChemical Optogenetics
Genetic modificationNot requiredRequiredRequiredNot required
Temporal precisionHigh (~ms)High (~ms)Low (min-hours)Medium (sec-min)
Cell-type specificityModerateHighHighModerate
ReversibilityYesYesLimitedYes
Duration of effectDays-weeksMonths-permanentDays-weeksHours-days

This systematic evaluation approach would establish whether OPN3-VLPs can serve as viable alternatives to existing optogenetic tools, particularly in contexts where genetic modification is undesirable or challenging .

How can researchers address potential immune responses to OPN3-VLPs in neurological applications?

Immune responses present significant challenges when applying OPN3-VLPs in neurological research, requiring specialized strategies:

  • Characterization of potential immunogenicity:

    • In vitro assessment using microglia and astrocyte cultures

    • Measurement of cytokine production upon OPN3-VLP exposure

    • Flow cytometry to detect immune cell activation markers

    • Histological evaluation after in vivo administration

  • Surface modification strategies:

    • PEGylation to create a hydrophilic shield

    • CD47 ("don't eat me" signal) coating to reduce phagocytosis

    • Anti-inflammatory molecule conjugation

    • Species-matched protein incorporation to reduce foreign epitope recognition

  • Administration approaches:

    • Local depletion of microglia before OPN3-VLP delivery

    • Co-administration with immunosuppressive agents

    • Use of alternative delivery routes (e.g., intranasal)

    • Gradual dose escalation protocols

  • Production considerations:

    • Rigorous endotoxin removal during purification

    • Host cell protein elimination

    • Implementation of specific pathogen testing

    • Production in systems with lower immunogenic potential

  • Monitoring strategies:

    • Real-time imaging of neuroinflammatory markers

    • Regular assessment of OPN3-VLP functional performance

    • Biomarker monitoring for immune activation

    • Histological evaluation at experimental endpoints

The blood-brain barrier provides some protection against systemic immune responses, but local inflammatory reactions remain a significant concern that must be systematically addressed to ensure reliable experimental outcomes with OPN3-VLPs in neurological applications .

What analytical methods are essential for characterizing OPN3-VLP preparations?

Comprehensive characterization of OPN3-VLP preparations requires multiple analytical approaches to ensure quality and reproducibility:

  • Physical characterization:

    • Dynamic light scattering for particle size distribution and polydispersity

    • Nanoparticle tracking analysis for concentration and size

    • Transmission electron microscopy for morphology and structural integrity

    • Zeta potential measurement for surface charge properties

  • Biochemical analysis:

    • SDS-PAGE and Western blotting for protein composition and integrity

    • HPLC for purity assessment and retinal content quantification

    • Mass spectrometry for protein identification and modification analysis

    • Circular dichroism for secondary structure confirmation

  • Functional characterization:

    • Absorption spectroscopy before and after light exposure

    • G-protein activation assays to confirm signaling capacity

    • Light-dependent conformational change assessment

    • Thermal stability testing through differential scanning fluorimetry

  • Analytical testing schedule:

Analysis MethodTesting StageCritical ParametersAcceptance Criteria
DLS/NTAPost-purificationSize, PDI80-120nm, PDI<0.2
TEMPre-releaseMorphology>80% intact particles
Absorption SpectroscopyPost-purification, stabilitySpectral maximum, light response470-500nm peak, >75% reference response
G-protein ActivationPre-releaseEC50, EmaxWithin 20% of reference
EndotoxinPre-releaseEndotoxin content<0.5 EU/mL

Implementing this analytical package ensures that each OPN3-VLP preparation meets predefined specifications for research applications and provides reproducible experimental results .

How should researchers address batch-to-batch variability in OPN3-VLP production?

Addressing batch-to-batch variability requires systematic quality management approaches:

  • Standardization of production process:

    • Implement detailed standard operating procedures (SOPs)

    • Use consistent cell banks and passage numbers

    • Standardize media formulations and supplements

    • Control environmental parameters (temperature, pH, dissolved oxygen)

  • Critical quality attribute monitoring:

    • Identify and monitor process parameters that impact final product quality

    • Implement in-process testing at defined production stages

    • Establish trending analysis to detect process drift

    • Develop predictive models relating process parameters to product quality

  • Reference standard establishment:

    • Create and characterize reference material from a representative batch

    • Store reference standards under validated conditions

    • Use references for side-by-side comparison with new batches

    • Periodically verify reference standard stability

  • Variability management framework:

Variability SourceMonitoring MethodControl StrategyAcceptance Criteria
Cell cultureViability, doubling timeStandardized expansion>90% viability, consistent growth
Expression levelWestern blot, yieldOptimized inductionWithin 20% of reference
VLP assemblySize distributionControlled conditionsCV<15%
Functional activityG-protein activationQuality by designWithin predefined limits
StabilityAccelerated testingOptimized formulationMeets shelf-life specs
  • Documentation and trending:

    • Maintain comprehensive batch records

    • Implement statistical process control charts

    • Conduct periodic process capability analysis

    • Establish corrective and preventive action procedures

By implementing these approaches, researchers can minimize variability and ensure consistent OPN3-VLP preparations across experiments, enabling reliable data generation and reproducible research findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.