Recombinant Human Opsin-5 (OPN5)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Signaling Mechanisms

Recombinant OPN5 exhibits bistable photochemical behavior and activates specific G-protein pathways:

  • Photocycle Dynamics:

    • UV light (380 nm) converts 11-cis retinal to all-trans retinal, forming a blue-absorbing photoproduct (λmax = 470 nm) .

    • Reverts to UV-sensitive state under orange light (>520 nm) .

  • G-Protein Coupling:

    G-Protein TypeSignaling PathwayExperimental ModelReference
    Gi/ocAMP inhibitionHEK293 cells
    Gq (via Gα14)Calcium mobilizationHEK293ΔGQ cells
    • Preferentially activates Gα14 over other Gq subtypes, triggering intracellular Ca²⁺ responses .

    • Light-induced MAPK phosphorylation observed in HEK293 and Neuro2a cells .

Calcium Signaling

  • Over 90% of HEK293 cells expressing recombinant OPN5 showed UV-dependent Ca²⁺ influx when reconstituted with 11-cis retinal .

  • Response amplitude decreased in retinal-free conditions, confirming chromophore dependency .

Circadian Rhythm Regulation

  • OPN5 knock-out mice studies revealed its role in photoentrainment of retinal and corneal circadian clocks .

  • UV sensitivity aligns with OPN5’s absorption spectrum, influencing melatonin suppression and thermoregulation .

Applications in Research

  • Calcium Imaging: Used to map light-induced signaling in neural and non-retinal tissues (e.g., outer ear epidermis) .

  • Drug Discovery: Screens for OPN5-targeted compounds modulating Gi/Gq pathways .

  • Circadian Biology: Tools for dissecting UV-dependent clock entrainment mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OPN5; GPR136; PGR12; TMEM13; Opsin-5; G-protein coupled receptor 136; G-protein coupled receptor PGR12; Neuropsin; Transmembrane protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGS LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFG TSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRI HSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE
Uniprot No.

Target Background

Function
Opsin-5 (OPN5) is a G-protein coupled receptor that selectively activates Gi-type G proteins via ultraviolet A (UVA) light-mediated activation in the retina. It preferentially binds the chromophore 11-cis retinal and functions as a bistable protein exhibiting emission peaks at 380 nm (UVA light) and 470 nm (blue light). OPN5 is essential for light responses in the inner plexiform layer and contributes to regulating light responses in the nerve fiber layer through phosphorylated DAT/SLC6A3 dopamine uptake. Further, OPN5 is involved in local corneal and retinal circadian rhythm photoentrainment by modulating the UVA light-induced phase shift of the retinal clock. In the outer ear, it acts as a circadian photoreceptor, modulating circadian clock gene expression in response to violet light during the light-to-dark transition and night phases. Finally, in the retina, OPN5 negatively regulates hyaloid vessel regression during postnatal development via light-dependent OPN5-SLC32A1-DRD2-VEGFR2 signaling, and is involved in the light-dependent regulation of dopamine levels in the retina and vitreous compartment.
Gene References Into Functions
  1. mRNA expression of the hNP gene in peripheral blood is significantly higher in patients with MRD compared to healthy subjects. PMID: 28636578
  2. Opsin 5 (OPN5) photoreceptor mediates light-induced Ca2+ response. PMID: 24941910
  3. Research implicates NRG1, a gene associated with schizophrenia susceptibility. PMID: 24614639
  4. Opn5m may function exclusively as a short-wavelength sensor in the brain and retina, facilitated by an 11-cis-retinal-supplying system. PMID: 24403072
  5. Human OPN5 triggers a UV-sensitive Gi-mediated signaling pathway in mammalian tissues. PMID: 22043319
  6. Genetic variation in the hNP gene may contribute to the molecular mechanisms of bipolar disorder and aspects of memory and intelligence. PMID: 18354391
Database Links

HGNC: 19992

OMIM: 609042

KEGG: hsa:221391

STRING: 9606.ENSP00000360255

UniGene: Hs.213717

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain and retina and cell lines derived from neural retina.

Q&A

What is human OPN5 and what is its spectral sensitivity?

Human OPN5 is a UV-sensitive opsin protein that belongs to an independent opsin group within the G protein-coupled receptor family. When reconstituted with 11-cis-retinal, human OPN5 exhibits an absorption maximum (λmax) at 380 nm, making it the first identified human opsin with peak sensitivity in the UV region . Upon UV-light illumination, OPN5 converts to a blue-absorbing photoproduct with λmax at approximately 470 nm . This photoproduct is stable in the dark and can revert to the UV-absorbing state through subsequent orange light illumination, demonstrating the bistable nature of human OPN5 .

How does OPN5 function in signal transduction?

OPN5 functions as a G protein-coupled receptor that can activate heterotrimeric G proteins in a UV-dependent manner. Research has demonstrated that OPN5 can trigger UV-sensitive Gi-mediated signaling pathways in mammalian tissues . More recent studies have revealed that OPN5 can also activate Gq-type G proteins, particularly showing preferential activation of Gα14 among Gq-type G proteins . This dual coupling capacity to both Gi and Gq-type G proteins suggests that OPN5 may regulate distinct signaling pathways depending on the cellular context and G protein availability.

Where is OPN5 expressed in mammalian tissues?

Immunoblotting analyses of mouse tissue extracts have identified the retina, brain, and unexpectedly, the outer ears as major sites of OPN5 expression . In tissue sections of mice, OPN5 immunoreactivities have been detected in:

  • A subset of non-rod/non-cone retinal neurons

  • Epidermal cells of the outer ears

  • Muscle cells of the outer ears

Most of these OPN5-immunoreactive cells in mice show co-localization with positive signals for the alpha-subunit of Gi, supporting the functional coupling of OPN5 with Gi-mediated signaling in these tissues . In situ hybridization studies have also revealed co-expression of Opn5m and Gna14a (encoding Gα14) in the scleral cartilage of medaka and chicken eyes, although Opn5m-positive cells in the neural retina were found to be Gna14a-negative .

What structural features determine the UV sensitivity of OPN5?

The UV sensitivity of OPN5 is determined by specific amino acid residues within its protein structure. Research has identified that the amino acid residue at position 188 plays a crucial role in determining the UV-sensitive bistable property of Opn5m . Comprehensive mutation studies at Thr188, which is well conserved among Opn5 proteins, have demonstrated that:

  • Mutations at position 188 in Opn5m drastically hampered 11-cis retinal incorporation and bistable photoreaction

  • The T188C mutant of Opn5m exclusively bound all-trans retinal and thermally self-regenerated to the original form after photoreception, resembling the photocyclic property of Opn5L1 (which naturally contains Cys188)

These findings indicate that the residue at position 188 is not only crucial for UV sensitivity but also contributes significantly to the diversification of vertebrate Opn5 subgroups with distinct photochemical properties .

How do different Opn5 orthologs and subgroups compare in their molecular properties?

Opn5 proteins from various vertebrate species share common UV sensitivity but display differences in their molecular properties and G protein coupling preferences. Comparative studies of Opn5m orthologs from mammals (human and mouse), birds (chicken), amphibians (Xenopus tropicalis), and teleosts (zebrafish and medaka) have revealed that all these Opn5m proteins can trigger intracellular calcium responses, although with varying intensities .

Additional Opn5 subgroups include:

Opn5 SubgroupSpectral PropertiesRetinal BindingPhotochemical Behavior
Opn5mUV-sensitive (λmax ~380 nm)Binds 11-cis retinalBistable photoreaction
Opn5L1Violet-sensitiveBinds all-trans retinalPhotocyclic property
Opn5L2UV-sensitiveBinds 11-cis retinalBistable photoreaction
Opn5m2 (zebrafish)UV-sensitiveBinds 11-cis retinalBistable photoreaction

These differences in molecular properties reflect the evolutionary diversification of Opn5 proteins, potentially allowing them to serve specialized functions across different species and tissue types .

Which G proteins are activated by human OPN5 and how is this coupling regulated?

Human OPN5 has been demonstrated to activate both Gi and Gq-type G proteins, though with different coupling efficiencies and potential physiological implications. While early studies established OPN5 as a Gi-coupled receptor capable of decreasing cellular cAMP levels upon UV stimulation , more recent investigations have revealed its ability to trigger calcium responses through activation of Gq-type G proteins .

Among the Gq family members (Gαq, Gα11, Gα14, and Gα15), OPN5 shows preferential activation of Gα14 . This preferential coupling appears to be a conserved property across Opn5m orthologs from different species, suggesting its functional significance. The molecular basis for this preference involves specific amino acid residues in Gα14 that enhance its interaction with OPN5, as demonstrated through experiments with point mutants and chimeric proteins of Gαq and Gα14 .

Key regions involved in the preferential activation of Gα14 by OPN5 include:

  • The α3-β5 loop

  • The αG helix

  • The αG-α4 loop

  • The α4 helix

  • The extreme C-terminus

The efficiency of activation is affected by specific amino acids in these regions, including Q265 in the α3-β5 loop, V289 and D290 in the αG helix, D296 in the αG-α4 loop, and E307, M312, F313, and V314 in the α4 helix .

How does OPN5 activation translate to intracellular calcium responses?

UV light illumination of cells expressing OPN5 induces a transient increase in intracellular calcium concentration, which can be measured using calcium-sensitive luminescent reporters like aequorin . This calcium response is dependent on the presence of Gq-type G proteins, as demonstrated by experiments in Gα-knockout cell lines (293TΔGQ) where no calcium response was observed in the absence of co-transfected Gq-type Gα subunits .

The calcium response pathway triggered by OPN5 activation likely involves:

  • UV-induced conformational change in OPN5

  • Activation of preferentially coupled Gq-type G proteins (particularly Gα14)

  • Stimulation of phospholipase C (PLC)

  • Generation of inositol trisphosphate (IP3)

  • Release of calcium from intracellular stores

The amplitude of this calcium response varies depending on the specific Opn5 ortholog and Gα subtype involved, with the OPN5-Gα14 combination consistently producing the strongest responses across species .

What are the recommended methods for expressing and reconstituting recombinant human OPN5?

For successful expression and reconstitution of functional recombinant human OPN5, researchers should consider the following methodological approaches:

  • Expression system: Human embryonic kidney (HEK) 293T cells or their derivatives have been successfully used for expression of OPN5 . These cells provide appropriate post-translational modifications and membrane targeting required for proper folding and function of OPN5.

  • Reconstitution with retinal:

    • OPN5 can be reconstituted with either 11-cis-retinal or all-trans-retinal (ATR) supplied in the culture medium

    • 11-cis-retinal reconstitution generally produces more intense responses than ATR, particularly for human OPN5, mouse Opn5, and zebrafish Opn5m2

    • This difference is likely related to the loss of direct ATR-binding ability in some OPN5 orthologs

  • Verification of functional expression: Western blot analysis following native PAGE can be used to estimate the relative expression levels of functional recombinant OPN5 and associated G proteins .

How can researchers effectively measure OPN5-mediated G protein signaling?

Several complementary approaches can be employed to assess OPN5-mediated G protein signaling:

  • Calcium response assays:

    • Aequorin luminescence assay using mitochondrial-targeted aequorin co-transfected with OPN5

    • This method allows detection of transient increases in intracellular calcium concentration upon UV stimulation

    • Addition of calcium chelators like BAPTA-AM can be used as controls to confirm the specificity of the response

  • cAMP assays:

    • Measurement of light-dependent decreases in cellular cAMP levels to assess Gi-mediated signaling

    • This approach is particularly relevant for physiological contexts where OPN5 primarily couples to Gi

  • [35S]GTPγS filter-binding assay:

    • Enables direct measurement of G protein activation by OPN5

    • Can help resolve discrepancies observed between different signaling readouts

  • Gα-knockout cell lines:

    • Use of Gα-knockout cells (e.g., 293TΔGQ) allows precise investigation of OPN5 coupling to specific G protein subtypes in a uniform assay format and cellular environment

    • Co-transfection with individual Gα subunits enables systematic evaluation of coupling preferences

What experimental approaches are suitable for characterizing OPN5 photochemistry?

The bistable nature of OPN5 and its UV sensitivity require specialized approaches for characterizing its photochemical properties:

  • Spectroscopic analysis:

    • Measurement of absorption spectra before and after UV illumination to determine λmax values

    • Monitoring of spectral shifts between the dark state (λmax ~380 nm) and photoproduct state (λmax ~470 nm)

    • Assessment of photoreversion from the photoproduct to the dark state upon orange light illumination

  • Retinal binding assays:

    • Comparative analysis of protein binding to 11-cis versus all-trans retinal

    • Assessment of retinal incorporation efficiency using radiolabeled or fluorescently tagged retinals

    • Monitoring of thermal stability and self-regeneration properties, particularly for mutant variants

  • Site-directed mutagenesis:

    • Systematic mutation of conserved residues (e.g., position 188) to probe structure-function relationships

    • Creation of chimeric proteins to identify domains responsible for specific photochemical properties

    • Analysis of mutant phenotypes to differentiate between bistable and photocyclic behaviors

How can researchers address discrepancies in OPN5 signaling observed in different experimental systems?

Researchers studying OPN5 signaling have observed discrepancies between different experimental approaches, particularly regarding the primary G protein coupling partner. To address these inconsistencies, consider the following strategies:

  • Multi-readout approach:

    • Employ complementary assays that measure different aspects of G protein signaling (cAMP, calcium, [35S]GTPγS binding)

    • Compare results across assays to build a comprehensive signaling profile

  • Consider cellular context:

    • The environment surrounding OPN5 and G proteins may influence coupling efficiency and signaling outcomes

    • Variations in membrane composition, expression of regulatory proteins, and availability of different G protein subtypes could affect signaling specificity

    • Studies in physiologically relevant cell types, such as hypothalamic cells where OPN5 naturally functions, may provide more accurate insights than heterologous expression systems

  • Address species-specific differences:

    • Molecular properties of OPN5 orthologs from different species may vary

    • Direct comparison of orthologs under identical experimental conditions can help identify conserved versus species-specific signaling mechanisms

  • Investigate alternative signaling pathways:

    • Consider that OPN5 may induce calcium responses through Gβγ-dependent pathways rather than canonical Gα-mediated mechanisms

    • Explore potential crosstalk between different G protein signaling cascades

What are the emerging research directions for human OPN5?

Based on current knowledge and unresolved questions, several promising research directions for human OPN5 include:

  • Physiological roles in human tissues:

    • Identification of all OPN5-expressing cell types in humans beyond the currently known locations

    • Elucidation of the physiological functions of OPN5-mediated UV sensing in these tissues

    • Investigation of potential roles in circadian rhythm regulation, light-dependent hormone secretion, or other non-visual photoreception processes

  • Structural biology:

    • Determination of the three-dimensional structure of human OPN5 in different activation states

    • Identification of the precise molecular interactions mediating preferential coupling to Gα14

    • Structural basis for UV sensitivity and bistable photochemistry

  • Signaling specificity and integration:

    • Comprehensive mapping of the OPN5 signalome in different cell types

    • Characterization of downstream effectors activated by OPN5-Gα14 versus OPN5-Gi pathways

    • Integration of OPN5 signaling with other light-sensitive and light-independent pathways

  • Therapeutic potential:

    • Exploration of OPN5 as a target for conditions involving aberrant UV sensing or related signaling pathways

    • Development of OPN5-specific agonists, antagonists, or allosteric modulators

    • Applications in optogenetics utilizing the UV sensitivity and bistable properties of OPN5

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.