Recombinant Human Organic solute transporter subunit alpha (OSTA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human OSTA (UniProt ID: Q86UW1) is a 340-amino acid protein expressed in Wheat germ systems for experimental use . As the alpha subunit of the Ost-alpha/Ost-beta heterodimer, it facilitates basolateral transport of bile acids, steroids, and eicosanoids in epithelial cells . This transporter is indispensable for:

  • Enterohepatic bile acid recirculation (reabsorbing >95% of bile acids)

  • Steroid metabolite homeostasis (e.g., estrone 3-sulfate)

  • Drug disposition (e.g., prostaglandin E2, certain pharmaceuticals)

Functional Mechanism

OSTA operates exclusively as a heterodimer with OSTβ (SLC51B):

Assembly Requirements

  • OSTβ’s N-terminal 35 residues bind OSTA’s extracellular domain .

  • Dimerization enables Endoplasmic Reticulum-to-Golgi trafficking via bafilomycin A1-sensitive vesicles .

Transport Mode

PropertyOSTα/β MechanismComparison to ABC Transporters
Energy DependenceFacilitated diffusion (ATP-independent)ATP-dependent (e.g., BSEP, MRP2)
Substrate DirectionBidirectional (follows electrochemical gradient)Unidirectional efflux
Primary SubstratesTaurocholate, estrone sulfate, prostaglandinsPhospholipids, conjugated toxins

This mechanism is critical for bile acid efflux from ileal enterocytes into portal blood .

4.1. Disease Associations

ConditionOSTα Expression ChangeImplications
Primary Biliary Cholangitis↑ 3–5 fold in hepatocytesCompensatory response to cholestasis
Nonalcoholic Steatohepatitis↑ 8–10 fold in liverLinked to bile acid-driven inflammation
OSTα/β genetic deficiencyLoss-of-function mutationsSevere diarrhea, cholestasis, fat-soluble vitamin deficiency

4.2. Pharmacological Relevance

  • Obeticholic acid (FXR agonist) upregulates OSTα/β, enhancing bile acid export .

  • Calphostin C (PKC inhibitor) disrupts OSTA membrane localization, reducing transport by 72% .

  • Cyclosporine A inhibits OSTA/β, contributing to drug-induced cholestasis .

Experimental Applications

Recombinant OSTA is utilized in:

Disease Modeling

  • Cholestasis: OSTα/β knockdown reduces bile acid clearance by 89% in hepatocyte models .

  • NASH: High-fat diets increase hepatic OSTα mRNA 4.7-fold in murine models .

Regulatory Pathways

OSTA expression is controlled by:

  1. Farnesoid X Receptor (FXR): Binds IR-1 elements in the OSTα promoter .

  2. Liver Receptor Homolog-1 (LRH-1): Suppresses OSTα under low bile acid conditions .

  3. PKC Signaling: Modulates vesicular trafficking to the basolateral membrane .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
SLC51A; OSTA; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC51A
Target Protein Sequence
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLL ALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTIT SFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLL MLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIIS RQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCH LLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA
Uniprot No.

Target Background

Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that functions as the intestinal basolateral transporter responsible for exporting bile acids from enterocytes into portal blood. It effectively transports the primary species of bile acids.
Gene References Into Functions
  1. SLC51A expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  2. OSTalpha plays roles in biological transport and is widely expressed in human tissues PMID: 12719432
  3. Human OSTalpha is a glycoprotein that requires interaction with OSTbeta for plasma membrane localization. However, glycosylation of OSTalpha is not essential for interaction with the beta subunit or membrane localization. PMID: 18847488
Database Links

HGNC: 29955

OMIM: 612084

KEGG: hsa:200931

STRING: 9606.ENSP00000296327

UniGene: Hs.630585

Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland and fat.

Q&A

What is human Organic Solute Transporter alpha (OSTA) and what is its primary function?

Human Organic Solute Transporter alpha (OSTA) is one subunit of a heterodimeric transport protein that functions in conjunction with OSTβ. Together, they form a functional transporter that mediates the export of bile acids and other organic solutes across the basolateral membrane of various epithelial cells, including intestinal enterocytes and hepatocytes .

The primary function of the OST complex is Na⁺-independent transport of bile acids and other steroid compounds. Unlike many transporters that work independently, OSTA requires physical association with OSTβ to achieve proper membrane localization and full transport functionality . This heterodimeric structure is essential for its role in bile acid homeostasis and the enterohepatic circulation of bile acids.

How do OSTA and OSTB interact to form a functional transporter?

The interaction between OSTA and OSTB subunits is critical for forming a functional transporter. Research has demonstrated that:

  • Physical association between OSTA and OSTB is essential for their polarized basolateral plasma membrane localization .

  • The extracellular amino-terminal portion of human OSTA plays an important role in the assembly of the heterodimer with OSTB .

  • Both the carboxyl and amino terminals of OSTB may contribute to heterodimer formation with OSTA, with specific domains having different roles in the interaction .

When expressed individually, neither subunit properly localizes to the plasma membrane nor exhibits transport activity. Only when co-expressed do they form a functional complex that can mediate Na⁺-independent bile acid transport .

What are the standard methods for expressing recombinant OSTA in cell models?

Standard methods for expressing recombinant OSTA in cell models include:

Transient Transfection:

  • COS-7 and HEK-293 cells are commonly used for transient expression studies .

  • FuGENE 6 transfection reagent has been successfully used for introducing OSTA/OSTB constructs into mammalian cells .

  • For co-expression studies, both OSTA and OSTB can be constructed in the pBudCE4.1 vector, which allows expression of multiple genes .

Stable Transfection:

  • MDCK cells are frequently used for stable expression, particularly for polarized transport studies .

  • The establishment protocol typically involves:

    • Seeding cells on day 1 (5 × 10⁴ cells per 60-mm plate)

    • Transfection with expression constructs on day 2 using appropriate reagents

    • Selection with antibiotics (G418 at 0.9 mg/ml and Zeocin at 250 μg/ml) beginning on day 3

    • Colony isolation and expansion after approximately 15 days

Expression Enhancement:

  • Treatment with 10 mM sodium butyrate for 16 hours at 37°C can induce higher expression of transfected genes .

What are the basic assays to measure OSTA-mediated transport activity?

Several assays can be used to measure OSTA-mediated transport activity:

Efflux Transport Assays:

  • Transwell Filter System: This method is commonly used for polarized cells and involves:

    • Growing cells on Transwell filter inserts

    • Loading cells with radiolabeled substrates (e.g., [³H]taurocholate) via apical transporters like Asbt

    • Measuring substrate efflux across the basolateral membrane

Uptake Transport Assays:

  • Direct Uptake: Measuring Na⁺-independent uptake of substrates like estrone-3-sulfate (E3S) or taurocholate (TC) in cells expressing OSTA/OSTB

Calculation Methods:

  • Transport activity is typically calculated as the percentage of substrate efflux, determined by measuring:

    • Cell-associated radioactivity

    • Radioactivity in the basolateral chamber

    • Radioactivity in the apical chamber

What experimental designs are most effective for studying OSTA-OSTB protein interactions?

Effective experimental designs for studying OSTA-OSTB protein interactions include:

Truncation and Mutation Studies:

  • Creating truncated versions of OSTA or OSTB (C-terminal or N-terminal truncations) to identify interaction domains

  • Site-directed mutagenesis of specific amino acid residues suspected to be involved in subunit interactions

Co-immunoprecipitation Assays:

  • Using epitope-tagged versions of OSTA and OSTB (e.g., GFP-tagged or 6xHis-tagged constructs)

  • Precipitating one subunit and testing for the presence of the other to confirm physical association

Confocal Microscopy:

  • Using fluorescence-tagged constructs to visualize co-localization

  • Assessing membrane trafficking in the presence of various mutations or truncations

Functional Transport Assays:

  • Combining transport activity measurements with protein interaction studies to correlate physical association with functional outcomes

  • Comparing wild-type and mutant constructs to identify critical interaction domains

The most robust experimental design incorporates multiple complementary approaches to validate protein interaction findings, as demonstrated in studies that combined:

  • Confocal microscopy to assess localization

  • Transport assays to measure functionality

  • Biochemical assays to confirm physical interactions

How do cytoskeletal components and signaling pathways influence OSTA membrane trafficking?

Cytoskeletal components and signaling pathways play crucial roles in OSTA membrane trafficking:

Cytoskeletal Involvement:

  • Previous studies on hepatic transporters indicate that polarized membrane expression is regulated by microtubule and actin-mediated pathways

  • Vesicle-mediated retrieval or insertion mechanisms facilitate transport protein trafficking to canalicular (apical) and sinusoid (basolateral) domains

Signaling Pathways:

  • Protein kinases likely influence OSTA trafficking, though the specific kinases involved require further investigation

  • Phosphorylation events may regulate the interaction between OSTA and OSTB or their association with trafficking machinery

Experimental Approaches:

  • Cytoskeleton-disrupting reagents can be used to assess the role of specific cytoskeletal components in OSTA trafficking

  • Protein kinase inhibitors help identify relevant signaling pathways

  • The effects of these treatments can be monitored through:

    • Changes in cellular distribution (via microscopy)

    • Alterations in efflux transport activity

Researchers studying OSTA trafficking should consider the interconnected nature of cytoskeletal elements and signaling pathways, as disruption of one component may have cascading effects on multiple aspects of protein localization and function.

What methodological considerations are important when designing experiments to study OSTA transport kinetics?

When designing experiments to study OSTA transport kinetics, researchers should consider:

Selection of Appropriate Cell Models:

  • Polarized epithelial cells (e.g., MDCK) provide a physiologically relevant model for studying vectorial transport

  • Non-polarized cells (e.g., COS-7, HEK-293) may be suitable for basic transport activity measurements

Transport Substrate Selection:

  • Common substrates include:

    • [³H]taurocholate (TC) for bile acid transport

    • [³H]estrone-3-sulfate (E3S) for steroid transport

  • Substrate concentration ranges should be appropriate for determining Km and Vmax values

Experimental Controls:

  • Expression of individual subunits (OSTA or OSTB alone) as negative controls

  • Inclusion of known transport inhibitors to confirm specificity

  • Vector-only transfected cells to account for endogenous transport

Technical Considerations:

  • Temperature control (typically 37°C) during transport assays

  • Careful timing of uptake/efflux periods (e.g., 5-10 minutes for initial rate measurements)

  • Buffer composition (Na⁺-containing vs. Na⁺-free to distinguish Na⁺-dependent from Na⁺-independent transport)

Data Analysis:

  • Use appropriate kinetic models (Michaelis-Menten, Hill equation, etc.)

  • Account for non-specific binding/transport

  • Consider multiple technical replicates (typically triplicate determinations) and biological replicates (different cell preparations)

What are the technical challenges in generating functional recombinant OSTA for structural studies?

Generating functional recombinant OSTA for structural studies presents several technical challenges:

Expression System Selection:

  • Mammalian cell systems provide proper post-translational modifications but yield lower protein amounts

  • Bacterial systems offer higher yields but may not provide appropriate folding or modifications

  • Insect cell systems represent a potential compromise between yield and proper processing

Heterodimeric Nature:

  • OSTA requires OSTB for proper function and stability

  • Co-expression and co-purification strategies are necessary

  • Maintaining the OSTA-OSTB interaction during purification is critical

Membrane Protein Solubilization:

  • Selection of appropriate detergents that maintain the native structure

  • Optimization of solubilization conditions to preserve the heterodimeric complex

  • Consideration of alternative approaches like nanodiscs or styrene maleic acid lipid particles (SMALPs)

Protein Stability:

  • Membrane proteins are often unstable when removed from their lipid environment

  • Addition of stabilizing agents or lipids may be necessary

  • Screening for thermostable mutants might improve success rates

Purification Challenges:

  • Designing effective purification tags that don't interfere with protein function

  • Sequential or tandem affinity purification may be necessary to isolate the intact heterodimer

  • Verification of functional activity after purification is essential

A systematic approach beginning with small-scale expression and functional testing, followed by optimization of solubilization and purification conditions, offers the best chance for success in structural studies of OSTA.

How can researchers interpret contradictory transport data when studying OSTA function?

When faced with contradictory transport data in OSTA research, consider the following analytical approach:

Methodological Variables to Assess:

VariablePotential ImpactResolution Strategy
Cell ModelDifferent endogenous transportersCompare transport in multiple cell lines; use knockout/knockdown approaches
Expression LevelsVariable OSTA:OSTB ratiosQuantify protein expression; normalize transport to expression levels
Membrane LocalizationImproper traffickingConfirm proper localization via microscopy before interpreting transport data
Transport ConditionsBuffer composition affects activityStandardize buffer components; test multiple conditions
Substrate SpecificityDifferent substrates show different kineticsUse multiple substrates; develop substrate profiles

Experimental Approaches to Resolve Contradictions:

  • Functional Comparison of Wild-type vs. Mutants:

    • Compare transport activities of wild-type and mutated OSTA/OSTB

    • Correlate changes in activity with specific structural alterations

  • Comprehensive Transport Assays:

    • Conduct both uptake and efflux assays

    • Compare Na⁺-dependent and Na⁺-independent transport

    • Assess transport in both apical-to-basolateral and basolateral-to-apical directions

  • Protein-Protein Interaction Analysis:

    • Verify that OSTA-OSTB heterodimer formation correlates with transport activity

    • Confirm proper localization using confocal microscopy

  • Data Normalization:

    • Calculate percentage of substrate efflux to normalize for variations in cellular uptake

    • Account for differences in expression levels when comparing constructs

What are common pitfalls in OSTA/OSTB co-expression experiments and how can they be addressed?

Common pitfalls in OSTA/OSTB co-expression experiments include:

Imbalanced Expression Levels:

  • Problem: Unequal expression of OSTA and OSTB subunits leading to limited heterodimer formation

  • Solution: Use bicistronic vectors like pBudCE4.1 that allow coordinated expression of both subunits ; verify expression levels by immunoblotting

Improper Localization:

  • Problem: Recombinant proteins fail to traffic to the plasma membrane

  • Solution: Verify localization using confocal microscopy before conducting transport assays ; include positive controls with known trafficking patterns

Low Transport Activity:

  • Problem: Minimal detectable transport despite confirmed expression

  • Solution: Enhance expression using sodium butyrate treatment ; optimize transport assay conditions (incubation time, substrate concentration)

Interference from Endogenous Transporters:

  • Problem: Background transport activity confounding results

  • Solution: Use appropriate control transfections (vector-only); consider cell lines with minimal endogenous transport activity

Poor Cell Polarization:

  • Problem: Lack of distinct apical and basolateral domains in polarized cell models

  • Solution: Ensure proper culture conditions for polarization; verify tight junction formation via transepithelial electrical resistance (TEER) measurements

Technical Approach to Address Multiple Issues:

  • Establish a systematic quality control process:

    • Verify mRNA expression via RT-PCR

    • Confirm protein expression via immunoblotting

    • Assess membrane localization via confocal microscopy

    • Measure transport function using standardized assays

  • Implement appropriate controls:

    • Individual subunit expressions

    • Known functional mutations

    • Vector-only transfections

What quantitative methods are most reliable for analyzing OSTA-mediated transport in different experimental models?

Reliable quantitative methods for analyzing OSTA-mediated transport include:

Radiotracer-Based Assays:

  • Advantages: High sensitivity; directly measures actual substrate movement

  • Implementation: Incubate cells with radiolabeled substrates ([³H]taurocholate or [³H]estrone-3-sulfate); measure accumulation or efflux via scintillation counting

  • Quantification: Calculate transport as percentage of substrate efflux or as pmol/mg protein/min

Fluorescent Substrate Assays:

  • Advantages: Avoids radioactivity; potential for real-time measurements

  • Implementation: Use fluorescent bile acid derivatives or other fluorescent OSTA substrates

  • Quantification: Measure via fluorescence microscopy or plate reader; normalize to cell number or protein content

Transwell Filter-Based Transport:

  • Advantages: Measures vectorial transport in polarized cells; distinguishes apical vs. basolateral processes

  • Implementation: Grow cells on permeable supports; apply substrate to one compartment and measure appearance in the other

  • Quantification: Calculate apparent permeability coefficients; determine efflux ratios

Mass Spectrometry-Based Methods:

  • Advantages: High specificity; can measure multiple substrates simultaneously

  • Implementation: Use LC-MS/MS to quantify substrate concentrations in cellular and media samples

  • Quantification: Develop standard curves; calculate transport rates based on substrate amounts

Data Analysis and Normalization Strategies:

MethodNormalization ApproachBest Application
Percentage Efflux(Effluxed substrate)/(Total loaded substrate) × 100Comparing different constructs within same experiment
Rate Calculationpmol substrate/(mg protein × time)Kinetic analyses; comparing across experiments
Efflux RatioBasolateral-to-apical/Apical-to-basolateral transportDetermining transport directionality
Transport-to-Expression RatioTransport activity/Protein expression levelCorrecting for expression differences between constructs

When selecting a quantification method, researchers should consider the specific research question, available equipment, and need for sensitivity versus throughput.

How can CRISPR/Cas9 technology be applied to study OSTA function in cellular models?

CRISPR/Cas9 technology offers powerful approaches for studying OSTA function:

Knockout Studies:

  • Generate complete OSTA knockout cell lines to establish baseline phenotypes

  • Create OSTB knockouts to confirm the requirement of both subunits for function

  • Develop double knockouts to eliminate potential compensatory mechanisms

Knock-in Applications:

  • Introduce epitope tags for easier detection without overexpression artifacts

  • Create fluorescent protein fusions at endogenous loci for live-cell imaging

  • Generate specific point mutations to study structure-function relationships

Experimental Design Considerations:

  • Guide RNA Selection:

    • Target conserved exons present in all splice variants

    • Avoid regions with potential off-target effects

    • Consider targeting multiple sites for complete knockout

  • Validation Methods:

    • Confirm genomic alterations via sequencing

    • Verify protein loss via immunoblotting

    • Assess functional consequences via transport assays

  • Rescue Experiments:

    • Reintroduce wild-type or mutated OSTA to confirm phenotype specificity

    • Use inducible expression systems for temporal control

  • Physiological Assessment:

    • Examine changes in bile acid homeostasis

    • Assess alterations in steroid hormone metabolism

    • Evaluate pharmaceutical substrate handling

This technology allows researchers to move beyond overexpression models to study OSTA in more physiologically relevant contexts, providing insights into its endogenous function and regulation.

What are the current methodological challenges in developing selective inhibitors or modulators of OSTA function?

Developing selective OSTA inhibitors or modulators presents several methodological challenges:

Heterodimeric Nature:

  • OSTA functions as a heterodimer with OSTB, complicating inhibitor design

  • Compounds may need to target the interface between subunits or allosterically modify the interaction

  • Screening systems must express both subunits in appropriate ratios

Assay Development:

  • High-throughput screening requires robust, reproducible assays

  • Transport assays are often low-throughput and technically challenging

  • Alternative assay formats (e.g., binding assays, conformational sensors) may need development

Selectivity Concerns:

  • OSTA/OSTB transports multiple substrates (bile acids, steroids)

  • Ensuring selectivity against other transporters requires extensive counter-screening

  • Compounds must be tested against related transporters to confirm specificity

Methodological Approaches:

ApproachAdvantagesLimitationsImplementation
Substrate-Based DesignLeverages known substrate interactionsMay lack selectivityModify known substrates to incorporate inhibitory features
Fragment ScreeningIdentifies diverse chemical starting pointsLow initial potencyUse biophysical methods to detect binding to purified protein
Virtual ScreeningCost-effective initial filteringRequires structural informationDock compounds to homology models or experimental structures
Phenotypic ScreeningIdentifies compounds with desired functional effectsMechanism often unclearScreen for altered bile acid accumulation in cell models

Validation Strategy:

  • Confirm direct OSTA/OSTB interaction using purified proteins

  • Demonstrate transport inhibition in cellular models

  • Verify selectivity against related transporters

  • Assess effects on physiological bile acid and steroid hormone handling

Overcoming these challenges requires multidisciplinary approaches combining structural biology, medicinal chemistry, and transport physiology.

What are the critical factors to consider when reporting OSTA research findings for publication?

When reporting OSTA research findings, researchers should consider these critical factors:

Methodological Transparency:

  • Provide detailed descriptions of experimental procedures, including:

    • Cell lines and passage numbers

    • Expression vector details and transfection methods

    • Specific buffer compositions and incubation conditions

    • Transport assay parameters (time, temperature, substrate concentrations)

  • Include sufficient methodological detail to allow reproduction by other laboratories

Data Presentation:

Controls and Validations:

  • Document expression verification (mRNA and protein levels)

  • Confirm proper membrane localization

  • Include negative controls (individual subunits, inactive mutants)

  • Validate antibody specificity for immunodetection methods

Contextual Integration:

  • Relate findings to existing literature on OSTA/OSTB

  • Address any contradictions with published work

  • Discuss physiological relevance of experimental observations

  • Consider implications for bile acid homeostasis and drug transport

Visual Presentation:

  • Include representative images from microscopy studies showing localization

  • Present transport data in clear, well-labeled graphs

  • Use schematic diagrams to illustrate proposed mechanisms

  • Ensure figure legends provide sufficient detail for independent interpretation

Adherence to these reporting standards enhances the reproducibility and impact of OSTA research findings, advancing our understanding of this important transport system.

How can researchers integrate OSTA transport studies with broader physiological investigations?

Researchers can integrate OSTA transport studies with broader physiological investigations through several strategic approaches:

Translational Models:

  • Correlate in vitro transport findings with ex vivo tissue samples

  • Develop organoid models that maintain physiological expression and polarization

  • Bridge cellular studies to animal models with tissue-specific manipulations of OSTA/OSTB

Physiological Parameters:

  • Extend transport studies to include physiological substrates beyond model compounds

  • Incorporate relevant physiological conditions (pH gradients, bile acid mixtures)

  • Consider the impact of hormonal regulation on OSTA function

Disease Relevance:

  • Investigate how pathological conditions alter OSTA expression or function

  • Examine potential roles in cholestatic disorders or inflammatory bowel disease

  • Explore implications for drug-induced liver injury or intestinal toxicity

Integrative Approaches:

  • Combine transport studies with metabolomic analysis of bile acid profiles

  • Correlate OSTA function with changes in nuclear receptor signaling

  • Investigate the impact of OSTA-mediated transport on tissue-specific gene expression

Methodological Integration:

Integration AreaApproachOutcome Measures
Bile Acid HomeostasisCombine in vitro transport with in vivo bile acid measurementsSerum and tissue bile acid profiles; fecal bile acid excretion
Drug DispositionCorrelate cellular transport with pharmacokinetic studiesDrug bioavailability; tissue distribution; elimination pathways
Metabolic RegulationLink OSTA function to metabolic signaling pathwaysGlucose homeostasis; lipid metabolism; energy expenditure
Inflammatory ProcessesAssess OSTA regulation during inflammationCytokine responses; tissue injury markers; barrier function

By integrating OSTA transport studies with broader physiological investigations, researchers can develop a more comprehensive understanding of the transporter's role in health and disease, potentially identifying new therapeutic targets or biomarkers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.