Recombinant Human Outcome predictor in acute leukemia 1 (OPA1L)

Shipped with Ice Packs
In Stock

Description

Introduction to OPA1L

Recombinant Human Outcome Predictor in Acute Leukemia 1 (OPA1L), also known as WW Domain Binding Protein 1-Like (WBP1L) or OPAL1, is a transmembrane adaptor protein linked to mitochondrial dynamics and leukemia prognosis. It was first identified as a gene (G0) with prognostic significance in pediatric acute lymphoblastic leukemia (ALL) . OPA1L is encoded by the WBP1L gene (Entrez Gene ID: 54838) and maps to chromosome 10q26.3 . Its recombinant form is utilized in research to study its structural and functional roles in leukemia biology.

Prognostic Significance in Leukemia

OPA1L’s prognostic role remains debated:

  • Association with TEL-AML1: OPA1L expression is 2.8-fold higher in TEL-AML1–positive ALL compared to TEL-AML1–negative cases, but this did not correlate with survival outcomes in COALL or St. Jude cohorts .

  • Drug Resistance: No consistent link was found between OPA1L expression and resistance to prednisolone, asparaginase, or daunorubicin. Paradoxically, higher OPA1L correlated with increased vincristine resistance .

Table 1: OPA1L Expression Across Leukemia Cohorts

CohortTEL-AML1–Positive (Median Expression)TEL-AML1–Negative (Median Expression)P-Value
COALL2.8-fold higherBaseline<0.001
St. Jude2.8-fold higherBaseline<0.001

Functional Insights and Mechanisms

While OPA1L’s exact function is unknown, hypotheses include:

  • Mitochondrial Dynamics: Structural similarities to mitochondrial proteins (e.g., cytochrome c) suggest a role in cristae integrity or electron transport .

  • Apoptosis Regulation: In other mitochondrial proteins (e.g., OPA1), oligomerization status influences cytochrome c release and apoptosis sensitivity . OPA1L may share analogous mechanisms.

Research Tools and Recombinant Applications

Recombinant OPA1L is critical for antibody development and functional studies:

  • Antibody Use: The monoclonal antibody OPAL1-01 (Thermo Fisher, MA5-28626) targets an intracellular epitope, aiding in flow cytometry and leukemia subtyping .

  • Therapeutic Exploration: Mitochondrial fusion/fission dynamics (e.g., via OPA1 inhibition) are emerging as AML therapeutic targets , though OPA1L’s direct involvement remains unconfirmed.

Current Research Gaps and Future Directions

  • Mechanistic Studies: OPA1L’s interaction with mitochondrial electron transport chains or apoptosis pathways requires validation.

  • Clinical Relevance: Its inconsistent prognostic value across treatment protocols warrants further cohort analyses .

  • Therapeutic Potential: Small-molecule modulators of mitochondrial dynamics (e.g., MYLS22 for OPA1 ) could inspire analogous strategies for OPA1L.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
WBP1L; C10orf26; OPA1L; WW domain binding protein 1-like; Outcome predictor in acute leukemia 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
WBP1L
Target Protein Sequence
MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCV CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPP PYSAFQLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPS DLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTP GRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLC QSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS
Uniprot No.

Target Background

Gene References Into Functions
  1. OPAL1 expression may not be an independent prognostic feature in childhood ALL, and its previously reported prognostic impact appears to be treatment dependent. PMID: 16709928
Database Links

HGNC: 23510

OMIM: 611129

KEGG: hsa:54838

STRING: 9606.ENSP00000414721

UniGene: Hs.500897

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is OPA1 and what is its primary cellular function?

OPA1 (Optic Atrophy 1) is a dynamin-related GTPase protein associated with the inner mitochondrial membrane that plays critical roles in mitochondrial fusion and cristae maintenance . It exists in two primary forms: a membrane-anchored long form (L-OPA1) and a soluble short form (S-OPA1) created through proteolytic cleavage of L-OPA1 . OPA1's primary functions include facilitating mitochondrial inner membrane fusion, maintaining cristae structure, and regulating mitochondrial energetics and respiratory function . Its activity is essential for adapting bioenergetics to cellular context, particularly in metabolically demanding environments such as those found in rapidly proliferating cancer cells .

How does OPA1 differ from other mitochondrial fusion proteins?

OPA1 is specifically involved in inner mitochondrial membrane fusion, while other fusion proteins like Mitofusins (MFN1 and MFN2) primarily mediate outer mitochondrial membrane fusion . Unlike mitofusins, OPA1 has a dual role in both membrane fusion and cristae structure maintenance . The unique feature of OPA1 is its processing from L-OPA1 to S-OPA1, which serves different functional roles—L-OPA1 confers fusion competence while S-OPA1 maintains oxidative phosphorylation and cristae structure . This processing is tightly regulated and responds to various cellular stresses, making OPA1 a key coordinator of mitochondrial dynamics in response to metabolic demands .

What are the structural differences between L-OPA1 and S-OPA1?

L-OPA1 (long form) contains an N-terminal mitochondrial targeting sequence followed by a transmembrane domain that anchors it to the inner mitochondrial membrane . S-OPA1 (short form) is generated through proteolytic cleavage of L-OPA1, resulting in loss of the transmembrane anchor, making it a soluble protein in the intermembrane space . Both forms retain the GTPase domain essential for OPA1 function, but their different localization and membrane association properties confer distinct functional capabilities . L-OPA1 is competent for mitochondrial fusion, while S-OPA1 is not fusion-competent but maintains cristae structure and respiratory function .

Why is OPA1 considered a therapeutic target in AML?

Mitochondrial metabolism has emerged as a critical dependency in acute myeloid leukemia cells, making the regulators of mitochondrial dynamics attractive therapeutic targets . Research using patient-derived xenograft (PDX) models has demonstrated that targeting mitochondrial fusion through genetic depletion or pharmacological inhibition of OPA1 exhibits significant anti-leukemic activity while minimally affecting normal hematopoietic cells . Mechanistically, inhibition of OPA1-mediated mitochondrial fusion disrupts mitochondrial respiration and reactive oxygen species (ROS) production, leading to cell cycle arrest at the G0/G1 transition in leukemic cells . This selective vulnerability of AML cells to OPA1 inhibition nominates it as a promising therapeutic target with a potentially favorable therapeutic window .

How does OPA1 expression differ between normal hematopoietic cells and AML cells?

The differential impact of OPA1 inhibition on leukemic versus normal hematopoietic cells suggests fundamentally different dependencies on mitochondrial fusion . While specific expression data comparing OPA1 levels in normal and leukemic cells wasn't explicitly provided in the search results, functional studies demonstrate that genetic depletion of MFN2 or OPA1 significantly reduced leukemia colony formation while having limited impact on normal hematopoietic progenitor cells . This differential dependency likely reflects the altered metabolic state of leukemic cells, which rely more heavily on mitochondrial respiration and may have adaptations that make them particularly vulnerable to disruptions in mitochondrial dynamics .

What experimental evidence supports OPA1 as a therapeutic target in AML?

Patient-derived xenograft (PDX) models have provided compelling evidence for OPA1 as a therapeutic target in AML . Genetic depletion of OPA1 or MFN2 in PDX samples resulted in shorter mitochondria (as measured by confocal imaging) and significant reduction in leukemia colony formation (L-CFU) . Quantitatively, when comparing the proportion of leukemic cells efficiently transduced with OPA1 shRNA vectors before and after methylcellulose culture, researchers observed a significant decrease in the output/input ratio compared to control shRNA . Additionally, pharmacological inhibition of OPA1 using the small molecule inhibitor MYLS22 demonstrated anti-leukemic activity while sparing normal murine or human hematopoietic cells in vitro and in vivo .

What are the optimal methods for assessing OPA1's role in mitochondrial dynamics within leukemic cells?

The optimal experimental approach involves a multi-modal assessment combining genetic manipulation, pharmacological inhibition, and functional readouts . For genetic manipulation, shRNA-mediated depletion of OPA1 provides insight into its necessity for leukemic cell function . Visualization of mitochondrial morphology through confocal microscopy after mitochondrial staining allows direct assessment of fusion/fission dynamics . Colony formation assays (L-CFU) provide functional readouts of leukemic cell viability and proliferation capacity following OPA1 manipulation . For pharmacological studies, compounds like MYLS22 that specifically inhibit OPA1 can be employed alongside appropriate controls to distinguish on-target from off-target effects . Importantly, parallel assessment in both leukemic and normal hematopoietic cells is essential to determine therapeutic selectivity .

How can researchers effectively measure the impact of OPA1 inhibition on mitochondrial respiration in leukemic samples?

Researchers can employ several complementary approaches to assess mitochondrial respiration following OPA1 inhibition . Oxygen consumption rate (OCR) measurements using platforms like Seahorse analyzers provide real-time quantification of mitochondrial respiratory capacity . Analysis of respiratory complex levels and assembly through blue native gel electrophoresis can reveal specific impacts on electron transport chain components . Mitochondrial membrane potential assessments using potential-sensitive dyes like TMRE or JC-1 indicate the functional integrity of the respiratory chain . Additionally, measuring ATP production rates and reactive oxygen species (ROS) levels provides insight into the bioenergetic consequences of OPA1 inhibition . For clinical samples with limited material, focused assessments of key respiratory complexes through Western blotting or immunofluorescence might be more practical than extensive respirometry .

What are the technical challenges in developing selective OPA1 inhibitors for leukemia treatment?

Developing selective OPA1 inhibitors faces several technical challenges . First, achieving selective inhibition of OPA1's GTPase activity without affecting other dynamin family GTPases requires detailed structural understanding and medicinal chemistry optimization . Second, differentiating between inhibition of L-OPA1 versus S-OPA1 may be critical, as these forms have distinct functions—ideally, therapeutic approaches should target fusion-competent L-OPA1 while preserving the cristae-maintenance function of S-OPA1 to minimize toxicity to normal tissues . Third, ensuring adequate mitochondrial penetration of inhibitors requires careful consideration of compound physicochemical properties . Finally, as demonstrated in liver-specific OPA1 knockout models, some tissues may develop compensatory mechanisms that overcome OPA1 inhibition, suggesting that combination approaches may be necessary for durable therapeutic effects in leukemia .

What molecular mechanisms regulate the balance between L-OPA1 and S-OPA1 in leukemic cells?

While the search results don't specifically address OPA1 processing in leukemic cells, general regulatory mechanisms can be inferred . The balance between L-OPA1 and S-OPA1 is regulated by proteolytic processing mediated by mitochondrial proteases, particularly OMA1 and YME1L . These proteases respond to different cellular stresses: OMA1 is activated during mitochondrial stress and depolarization, while YME1L responds to changes in cellular ATP levels . In leukemic cells, which often experience metabolic stress and altered energy demands, this proteolytic balance may be shifted toward increased S-OPA1 production . Additional regulation occurs at the level of alternative splicing of OPA1 mRNA, generating different variants with varying susceptibility to proteolytic cleavage . Understanding these regulatory mechanisms in the specific context of leukemia metabolism could reveal new therapeutic vulnerabilities .

What are the most effective genetic approaches for studying OPA1 function in leukemic models?

The most effective genetic approaches for studying OPA1 in leukemia include shRNA-mediated knockdown and CRISPR/Cas9-based editing . ShRNA approaches allow for titrated reduction in OPA1 expression and are particularly useful in primary patient samples and PDX models where complete knockout might be lethal . For mechanistic studies, inducible shRNA or CRISPR systems enable temporal control over OPA1 depletion and facilitate the distinction between immediate versus adaptive responses . Complementation studies using expression of shRNA-resistant OPA1 variants (including those specifically designed to generate only L-OPA1 or S-OPA1) can dissect isoform-specific functions . For in vivo studies, xenotransplantation of genetically modified leukemic cells into immunodeficient mice provides a physiologically relevant context to assess the impact of OPA1 manipulation on leukemia progression and therapy response .

How can researchers evaluate the specificity of pharmacological OPA1 inhibitors?

Evaluating the specificity of OPA1 inhibitors requires a multi-layered approach . Biochemical assays using purified OPA1 protein to measure direct GTPase inhibition establish target engagement and potency . Counterscreening against related GTPases (other dynamin family members) assesses selectivity within the protein family . Cellular phenotypic assays comparing the effects of the inhibitor to those of genetic OPA1 depletion help confirm on-target activity . Importantly, rescue experiments using inhibitor-resistant OPA1 mutants provide strong evidence for specificity . Molecular dynamics modeling and structural studies can reveal inhibitor binding modes and inform rational design of more selective compounds . For the compound MYLS22 mentioned in the search results, its selectivity was validated by demonstrating anti-leukemic activity similar to genetic OPA1 depletion while sparing normal hematopoietic cells, suggesting acceptable target specificity .

What experimental design would best assess OPA1 inhibition in combination with standard AML therapies?

An optimal experimental design for evaluating OPA1 inhibition in combination with standard AML therapies would incorporate both in vitro and in vivo approaches with appropriate controls . In vitro experiments should include:

  • Dose-response matrices of OPA1 inhibitors combined with standard agents (cytarabine, anthracyclines, FLT3 inhibitors) to determine synergy, additivity, or antagonism using methods like Chou-Talalay analysis .

  • Mechanistic assessments to determine if combinations enhance cell cycle arrest, apoptosis, or differentiation compared to single agents .

In vivo studies should include:

  • PDX models treated with clinically relevant regimens of standard agents with or without OPA1 inhibitors, assessing tumor burden, survival, and minimal residual disease .

  • Assessment of normal tissue toxicity to determine therapeutic window .

All studies should include diverse AML subtypes to identify genetic or molecular features that predict combination sensitivity . Additionally, ex vivo drug sensitivity testing of primary patient samples would provide translational validation of promising combinations .

How do findings on OPA1 function in AML contrast with its role in other tissues?

Research reveals interesting contrasts in OPA1 function between AML and other tissues, particularly the liver . In AML, OPA1 inhibition has significant anti-leukemic activity, suggesting it is essential for leukemia cell survival and proliferation . In contrast, liver-specific OPA1 knockout (LKO) mice were unexpectedly healthy with unaffected mitochondrial respiration despite disrupted cristae morphology . This tissue-specific dispensability of OPA1 in liver is explained by the induction of a stress response that establishes a new homeostatic state for sustained liver function . Unlike in AML, where OPA1 inhibition disrupts mitochondrial respiration, OPA1 LKO liver maintained respiratory function through compensatory mechanisms . Interestingly, OPA1 LKO even protected the liver from drug toxicity by decreasing toxic drug metabolism and conferring resistance to mitochondrial permeability transition . These tissue-specific differences suggest that targeting OPA1 in AML could have a favorable therapeutic window with minimal hepatotoxicity .

What are the current limitations in translating OPA1-targeted therapies from preclinical models to clinical trials?

Several limitations currently challenge the translation of OPA1-targeted therapies to clinical trials . First, while preclinical models show promising anti-leukemic activity, the long-term consequences of OPA1 inhibition in humans remain unknown, particularly given its essential role in certain tissues like the optic nerve (mutations cause autosomal dominant optic atrophy) . Second, pharmacological tools for OPA1 inhibition are still in early development stages, with compounds like MYLS22 requiring further optimization for drug-like properties and pharmacokinetics before clinical testing . Third, patient selection strategies are underdeveloped—biomarkers that predict sensitivity to OPA1 inhibition need to be identified to enable precision medicine approaches . Fourth, potential resistance mechanisms haven't been fully characterized; as seen in liver tissue, compensatory responses may develop that overcome OPA1 inhibition . Finally, optimal combination strategies with standard therapies need refining to maximize efficacy while minimizing toxicity . Addressing these limitations requires continued mechanistic research alongside medicinal chemistry efforts to develop clinical-grade OPA1 inhibitors with defined pharmacology .

What quantitative data supports the role of OPA1 in AML pathogenesis?

The following table summarizes key quantitative findings supporting OPA1's role in AML pathogenesis:

Experimental ApproachMeasurementFindingReference
PDX samples with MFN2 or OPA1 depletionMitochondrial lengthSignificant shortening of mitochondria observed via confocal imaging
PDX samples with MFN2 or OPA1 depletionLeukemia colony formation (L-CFU)Significant reduction in colony-forming capacity
Methylcellulose culture with OPA1 shRNAOutput/input ratio of transduced cellsRatio of 0.86 in control vs significant decrease with OPA1 depletion
Mechanistic assessmentCell cycle analysisArrest at G0/G1 transition following OPA1 inhibition
OPA1 inhibitor (MYLS22) testingAnti-leukemic activitySignificant activity while sparing normal hematopoietic cells

These quantitative findings demonstrate that OPA1 is essential for maintaining mitochondrial morphology, leukemic cell proliferation, and cell cycle progression in AML models .

How does the functional impact of OPA1 inhibition compare across different experimental systems?

The table below compares OPA1 inhibition effects across different experimental systems:

Experimental SystemMethod of OPA1 InhibitionEffect on Mitochondrial MorphologyEffect on RespirationEffect on Cell ViabilityReference
AML cell linesGenetic depletion (shRNA)FragmentationDisruptedDecreased viability
Patient-derived AML cellsGenetic depletion (shRNA)Shorter mitochondriaDisruptedReduced colony formation
AML modelsPharmacological (MYLS22)FragmentationDisruptedAnti-leukemic activity
Liver-specific knockoutGenetic (AAV8-TBG-Cre)Disrupted cristaeUnaffectedNo change in viability
OPA1-null cells + S-OPA1 onlyGenetic reconstitutionFragmentedMaintainedNormal growth

This comparative analysis reveals tissue-specific responses to OPA1 inhibition, with AML cells showing particular vulnerability compared to liver tissue or cells expressing S-OPA1 only . These differences highlight the potential therapeutic window for OPA1 targeting in leukemia.

What is the current evidence for OPA1 inhibition as a therapeutic strategy in different leukemia subtypes?

Current evidence for OPA1 inhibition across leukemia subtypes is summarized below:

Leukemia SubtypeStage of EvidenceKey FindingsPotential Clinical ApplicationReference
Acute Myeloid Leukemia (AML)Preclinical (PDX models)Genetic depletion or pharmacological inhibition of OPA1 shows significant anti-leukemic activityFirst-line or salvage therapy
AML with high mitochondrial massPreclinical inferenceHigher dependency on mitochondrial function suggests increased sensitivity to OPA1 inhibitionBiomarker-guided therapy
Treatment-resistant AMLPreclinical inferenceNovel mechanism of action may overcome resistance to conventional therapiesSalvage therapy
Other leukemia subtypesNot specifically addressed in search resultsRequires further investigationTo be determinedN/A

While the search results primarily focus on AML, the mechanistic insights suggest that OPA1 inhibition could potentially be effective across multiple leukemia subtypes that share dependence on mitochondrial metabolism . Further research is needed to characterize differential sensitivities and develop appropriate biomarkers for patient selection.

How does the GTPase activity of OPA1 mechanistically contribute to mitochondrial maintenance in leukemic cells?

The GTPase activity of OPA1 is critical for both its fusion-promoting and cristae-maintaining functions in leukemic cells . Research has shown that this enzymatic activity drives conformational changes that facilitate membrane remodeling during fusion events and stabilize cristae junctions . In leukemic cells, which rely heavily on mitochondrial metabolism, OPA1's GTPase activity helps maintain cristae tightness, optimizing the efficiency of the electron transport chain complexes that reside within these structures . This optimization is particularly important in the metabolically demanding environment of rapidly proliferating leukemic cells . Remarkably, the GTPase activity is required for maintaining cristae structure and respiratory function even in the absence of fusion, as demonstrated by studies with S-OPA1, which lacks fusion capacity but maintains cristae organization through its GTPase domain . Targeting this enzymatic activity specifically may therefore disrupt both mitochondrial architecture and bioenergetics in leukemic cells .

What role do post-translational modifications of OPA1 play in regulating its function in normal versus leukemic hematopoiesis?

While the search results don't specifically address post-translational modifications (PTMs) of OPA1 in leukemic contexts, general principles can inform advanced research questions . PTMs likely serve as rapid response mechanisms to adjust mitochondrial dynamics to changing metabolic needs in hematopoietic cells . These modifications may include phosphorylation, ubiquitination, acetylation, and SUMOylation, each potentially regulating different aspects of OPA1 function—GTPase activity, protein-protein interactions, or susceptibility to proteolytic processing . In leukemic transformation, dysregulation of these PTMs could alter the balance between fusion and fission, contributing to the metabolic adaptation that supports unlimited proliferation . Comparing the PTM profiles of OPA1 between normal hematopoietic stem cells and leukemic blasts could reveal cancer-specific modifications that might be targeted therapeutically . Additionally, identifying the kinases, phosphatases, or other enzymes responsible for these modifications could expand the repertoire of potential therapeutic targets beyond OPA1 itself .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.