Recombinant Human Outer dense fiber protein 4 (ODF4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Outer Dense Fiber Protein 4 (ODF4)

Recombinant Human Outer Dense Fiber protein 4 (ODF4) is a protein derived from the full-length sequence of the human outer dense fiber of sperm tails 4, transcript variant 1 (NM_153007) .

The outer dense fibers (ODF) form a major cytoskeletal structure in sperm tails . Despite their crucial role in sperm tail morphology and function, their constituents have remained poorly described . Research indicates that human ODF consists of approximately 10 major and at least 15 minor proteins, with all major proteins being ODF1, ODF2, or ODF2-related proteins .

ODF4 Gene and Protein Characteristics

Two slightly different cDNAs encoding ODF2 proteins of approximately 70 kDa have been isolated from a human testis cDNA library . Human ODF2 cDNAs and their encoded proteins are very similar to those isolated from rat and mouse, suggesting a high evolutionary pressure on these proteins . Transcription of ODF2 is restricted to testis tissue and, more specifically, to round spermatids, as demonstrated by non-radioactive in-situ hybridization . ODF2 proteins have been detected in the sperm tail, with their distribution along the length of the sperm tail showing that the ODF normally extend to about half the principal piece of the sperm tail .

Expression and Function

Microfibrillar-associated protein 4 (MFAP4), an extracellular matrix protein, has been found to be notably upregulated in oral submucous fibrosis (OSF) tissues . MFAP4 is a ubiquitous protein that plays an increasingly noteworthy part in elastin fiber formation and ECM remodeling processes during vascular injury and multitudinous fibrotic diseases, including myocardium, liver, joint, and renal fibrosis .

Clinical Significance

Increased expression of MFAP4 and tropoelastin (TE) proteins is involved in the progression of OSF . Clinical OSF samples at different stages were analyzed by immunohistochemistry and the findings indicated more intense blue staining in the submucosa due to collagen deposition in all OSF tissues compared with that in control tissues . Strong MFAP4 immunoreactivity was identified in the subepithelial connective tissues of these OSF tissues at different stages .

Statistical analyses showed that the expression level of MFAP4 was positively associated with TE, with a Pearson correlation coefficient of 0.3781 (p = 0.0048) . A significant positive correlation between MFAP4 and TE expression in the OSF submucosa area suggests that they are closely associated with the progression of OSF .

Recombinant Protein Production and Characteristics

Recombinant proteins, such as Recombinant Human Olfactomedin-4/OLFM4 His-tag Protein, are produced in cell lines like Chinese Hamster Ovary (CHO) cells . These recombinant proteins often include tags, such as a 6-His tag, for purification and detection .

Table 1: Characteristics of Recombinant Human Olfactomedin-4/OLFM4 His-tag Protein

CharacteristicDetail
SourceChinese Hamster Ovary cell line, CHO-derived human Olfactomedin-4/OLFM4 protein
Amino Acid SequenceAsp21-Gln510, with a C-terminal 6-His tag
Purity>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
Endotoxin Level<0.10 EU per 1 μg of the protein by the LAL method
N-terminal Sequence AnalysisAsp21
Predicted Molecular Mass56 kDa
SDS-PAGE66-75 kDa, under reducing conditions
ActivityMeasured by the ability of the immobilized protein to support the spreading of NIH3T3 mouse embryonic fibroblast cells. Recombinant Human Olfactomedin-4/OLFM4 His-tag immobilized at 0.5-1 μg/mL will significantly support cell spreading.
FormulationLyophilized from a 0.2 μm filtered solution in PBS
ReconstitutionReconstitute at 500 μg/mL in PBS
Stability & StorageUse a manual defrost freezer and avoid repeated freeze-thaw cycles

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ODF4; OPPO1; Outer dense fiber protein 4; Outer dense fiber of sperm tails protein 4; Testis-specific protein oppo 1; hOPPO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ODF4
Target Protein Sequence
MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV
Uniprot No.

Target Background

Function
A component of the sperm outer dense fibers (ODFs), ODF4 is implicated in sperm tail structure, motility, and overall cytoskeletal organization.
Gene References Into Functions
  1. ODF4, a cancer-testis (CT) gene, aids in chronic myeloid leukemia (CML) detection. It was expressed in 30% of CML patients but not in healthy controls. PMID: 22588436
  2. While its genomic structure has evolved independently in mice, its functional structure is highly conserved. PMID: 12728016
Database Links

HGNC: 19056

OMIM: 610097

KEGG: hsa:146852

STRING: 9606.ENSP00000331086

UniGene: Hs.186045

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in testis and sperm; especially localized to sperm tail (at protein level).

Q&A

What is Outer dense fiber protein 4 and what is its biological significance?

Outer dense fiber protein 4 (ODF4) is a protein localized in the outer dense fibers of mature sperm tails. It plays a crucial role in maintaining the structural integrity and functionality of sperm flagella. ODF4 is encoded by a gene that appears to have specialized functions related to sperm tail physiology and potentially sperm motility. The protein is considered important for reproductive biology research, particularly in studies of male fertility and sperm function .

From a structural perspective, ODF4 is part of a family of proteins that form the cytoskeletal elements of sperm tails. These dense fibers provide both elastic recoil and protection against shearing forces during sperm movement. Understanding ODF4's exact function requires examining its interactions with other outer dense fiber proteins and its role in maintaining sperm tail integrity and movement patterns.

What are the common synonyms and identifiers for ODF4 in scientific literature?

When conducting literature searches or database queries, researchers should be aware of the various nomenclature used for ODF4. The protein is referenced under multiple designations including:

  • Outer dense fiber of sperm tails 4

  • Outer dense fiber protein 4

  • Cancer/testis antigen 136 (CT136)

  • Cancer/testis antigen 134 (CT134)

  • OPPO1 (or hOPPO1)

  • Testis-specific protein oppo 1

  • MGC138215 and MGC138219 (GenBank identifiers)

Understanding these alternative designations is essential for comprehensive literature searches, especially when exploring ODF4 across different research contexts including reproductive biology, cancer research, and comparative genomics.

How does recombinant ODF4 expression differ between mammalian and bacterial systems?

Recombinant human ODF4 can be produced in various expression systems, each with distinct advantages and limitations for research applications:

Expression SystemAdvantagesLimitationsTypical YieldPost-translational Modifications
Mammalian Cells (HEK293)Native-like folding and post-translational modificationsHigher cost, longer production timeModerate (2-5 mg/L)Extensive and authentic
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential for inclusion bodiesHigh (5-20 mg/L)Limited or absent

The choice of expression system significantly impacts protein functionality. Mammalian expression systems like HEK293 cells typically produce ODF4 with post-translational modifications that more closely resemble the native protein, which is critical for functional studies. E. coli-expressed ODF4 may require additional refolding steps to achieve proper conformation but offers advantages for structural studies requiring higher protein yields .

What are the critical variables to consider when designing experiments involving recombinant ODF4?

When designing experiments with recombinant ODF4, researchers must systematically address several key experimental design considerations:

Independent Variables:

  • Concentration of recombinant ODF4 (typically ranging from 10-1000 ng/mL)

  • Duration of exposure/treatment

  • Cell or tissue type (e.g., reproductive tissues, sperm samples)

  • Presence of interacting proteins or molecules

Dependent Variables:

  • Protein-protein interaction measurements

  • Changes in cell morphology

  • Alterations in sperm motility parameters

  • Gene expression changes

Extraneous Variables to Control:

  • Temperature and pH conditions

  • Storage duration of recombinant protein

  • Batch-to-batch variations

  • Contamination with endotoxins

Properly controlling these variables requires careful planning. For instance, when studying ODF4's interactions with other sperm tail proteins, researchers should use appropriate controls including inactive protein variants, carrier-only controls, and wildtype cells for comparison with targeted mutations .

How can I validate the functional activity of recombinant ODF4?

Validating recombinant ODF4 functionality requires multiple complementary approaches:

  • Structural Validation:

    • Circular dichroism spectroscopy to confirm proper protein folding

    • Size-exclusion chromatography to verify monodispersity

    • Western blotting with conformation-specific antibodies

  • Interaction Validation:

    • Co-immunoprecipitation with known binding partners

    • Surface plasmon resonance to measure binding kinetics

    • Yeast two-hybrid screening for novel interactions

  • Functional Assays:

    • Sperm motility assays following incubation with recombinant ODF4

    • Competitive binding experiments with native ODF4

    • Microscopy-based localization studies in sperm cells

For rigorous validation, researchers should employ multiple methods across these categories. For example, structural validation alone cannot confirm biological activity, while functional assays provide incomplete information without confirmed structural integrity.

What experimental designs are most effective for studying ODF4 interactions with other sperm tail proteins?

For studying ODF4 protein interactions, consider these experimental designs:

  • Factorial Design for Multiple Protein Interactions:

    • Systematically vary combinations of ODF4 with other outer dense fiber proteins (e.g., ODF1, ODF2)

    • Measure binding affinity, complex formation, and functional outcomes

    • This design allows assessment of synergistic effects between multiple proteins

  • Dose-Response Design:

    • Vary ODF4 concentration while keeping interacting protein constant

    • Determine saturation points and half-maximal effective concentrations

    • Essential for understanding stoichiometry of interactions

  • Time-Course Experiments:

    • Monitor interaction dynamics over time

    • Particularly important for assembly/disassembly studies of sperm tail structures

When designing these experiments, randomization of treatment order and blinding of outcome assessors are critical for minimizing bias. Additionally, power analysis should be conducted to ensure sufficient sample sizes for detecting biologically relevant effects .

What analytical techniques provide the most insightful data for ODF4 structural studies?

For advanced structural characterization of recombinant ODF4, researchers should consider these complementary techniques:

How should researchers address data variability and contradictions in ODF4 functional studies?

When confronting contradictory findings in ODF4 research, implement this methodological framework:

  • Systematic Evaluation of Methodological Differences:

    • Compare protein preparation methods (expression systems, purification protocols)

    • Examine differences in experimental conditions (buffer composition, temperature)

    • Assess analytical techniques (sensitivity, specificity, resolution)

  • Statistical Approaches for Reconciling Contradictions:

    • Meta-analytical techniques to pool data across studies

    • Bayesian methods to incorporate prior knowledge and update with new evidence

    • Sensitivity analyses to identify influential parameters driving contradictions

  • Experimental Design for Resolution:

    • Design experiments specifically targeting contradictory findings

    • Include conditions from conflicting studies within the same experimental setup

    • Use factorial designs to identify interaction effects that may explain discrepancies

When reporting such investigations, researchers should transparently document all methodological details and present both supporting and contradicting evidence. This approach strengthens the field by identifying sources of variability rather than dismissing contradictory findings.

What regression models are most appropriate for analyzing ODF4's impact on sperm motility parameters?

When analyzing the relationship between ODF4 expression/activity and sperm motility parameters, consider these regression approaches:

  • Multiple Linear Regression:

    • Basic formula structure: Motility Parameter = β₀ + β₁(ODF4 Concentration) + β₂(Other Factor) + ... + ε

    • Appropriate when relationships appear linear and assumptions of normality are met

    • Allows quantification of relative contributions of multiple factors

  • Generalized Linear Models:

    • Extensions of linear regression for non-normally distributed outcomes

    • Particularly useful for count data (e.g., number of motile sperm) or binary outcomes

  • Mixed-Effects Models:

    • Account for both fixed effects (e.g., ODF4 concentration) and random effects (e.g., donor variation)

    • Formula example: Motility = β₀ + β₁(ODF4) + b₁(Donor) + ε where b₁ represents random effects

    • Essential when using repeated measures or hierarchical sampling designs

For example, a researcher might use a mixed-effects model to analyze how varying concentrations of recombinant ODF4 affect sperm motility parameters while accounting for variation between sperm donors. This approach enables more accurate estimation of ODF4's effects by properly modeling the data structure.

What controls are essential in experiments using recombinant human ODF4?

Rigorous ODF4 research requires comprehensive controls:

  • Protein-Specific Controls:

    • Heat-denatured ODF4 (negative control for structure-dependent functions)

    • Site-directed mutants with altered functional domains

    • Tagged vs. untagged protein comparisons to assess tag interference

  • System-Specific Controls:

    • Empty vector-transfected cells for recombinant expression systems

    • Vehicle controls matched to the protein buffer

    • Isotype control antibodies for immunological detection methods

  • Biological Controls:

    • ODF4-depleted sperm samples

    • Sperm samples from model organisms with ODF4 mutations

    • Normal vs. abnormal sperm with differing ODF4 expression levels

Implementation of these controls helps distinguish true biological effects from experimental artifacts. For instance, comparing results from wildtype ODF4 with a phosphorylation-site mutant could reveal the importance of specific post-translational modifications in protein function.

How can researchers accurately quantify ODF4-protein interactions in complex biological samples?

For quantitative analysis of ODF4 interactions in complex samples like sperm extracts, consider these methodological approaches:

  • Proximity Ligation Assay (PLA):

    • Detects protein-protein interactions with high specificity in situ

    • Provides spatial information about interaction locations

    • Can detect endogenous protein interactions without overexpression

  • Quantitative Immunoprecipitation Combined with Knockdown (QUICK):

    • Combines siRNA knockdown with quantitative immunoprecipitation

    • Allows discrimination between direct and indirect interactions

    • Provides relative interaction strengths

  • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with IP-MS:

    • Enables quantitative comparison of interaction partners across conditions

    • High specificity and discovery potential for novel interactions

    • Requires specialized mass spectrometry equipment and expertise

For comprehensive analysis, researchers should use complementary techniques. For example, initial screening with IP-MS might identify potential interaction partners, followed by PLA to confirm and localize specific interactions of interest within the cellular context.

What statistical approaches are most appropriate for comparing ODF4 expression across different experimental conditions?

When analyzing ODF4 expression data across experimental conditions, researchers should select statistical methods based on data characteristics:

  • For Normally Distributed Data:

    • t-tests for comparing two conditions

    • ANOVA with appropriate post-hoc tests for multiple conditions

    • ANCOVA when controlling for covariates like cell type or developmental stage

  • For Non-Normally Distributed Data:

    • Mann-Whitney U test for two-group comparisons

    • Kruskal-Wallis test with Dunn's post-hoc for multiple groups

    • Rank-based nonparametric ANCOVA for controlling covariates

  • For Time-Series or Repeated Measures:

    • Repeated measures ANOVA if assumptions are met

    • Mixed-effects models for complex designs or missing data

    • Generalized estimating equations for population-average effects

The choice of statistical approach should be determined a priori and justified based on data characteristics. For example, a study comparing ODF4 expression between normal and pathological sperm samples might use Mann-Whitney U tests if the data show significant skewness, while a time-course study of ODF4 expression during spermatogenesis would require repeated measures analysis.

How should researchers interpret conflicting results between in vitro and in vivo ODF4 studies?

When faced with discrepancies between in vitro and in vivo ODF4 findings, employ this systematic interpretive framework:

  • Context-Dependent Function Analysis:

    • Evaluate whether differences result from missing cellular context in vitro

    • Consider the presence/absence of interacting partners in different systems

    • Assess whether post-translational modifications differ between systems

  • Physiological Relevance Assessment:

    • Compare concentrations used in vitro with physiological levels

    • Evaluate temporal dynamics (acute vs. chronic exposure)

    • Consider compartmentalization that may exist in vivo but not in vitro

  • Integrative Modeling Approach:

    • Develop conceptual or computational models that account for both data sets

    • Identify parameters that might reconcile divergent findings

    • Design bridging experiments to test these parameters

Rather than viewing conflicting results as problematic, researchers should use them to generate hypotheses about context-dependent functions. For example, if recombinant ODF4 shows different binding properties in vitro versus in sperm cells, this might reveal important regulatory mechanisms that only operate in the cellular environment.

How can CRISPR-Cas9 gene editing be optimized for studying ODF4 function?

CRISPR-Cas9 approaches offer powerful tools for ODF4 functional studies, with these methodological considerations:

  • Target Site Selection:

    • Use multiple prediction algorithms to identify optimal gRNA target sites

    • Target functional domains based on structural predictions

    • Create domain-specific knockouts rather than complete gene ablation

  • Validation Strategies:

    • Employ multiple validation methods (sequencing, Western blot, RT-qPCR)

    • Create rescue lines expressing wildtype ODF4 to confirm specificity

    • Use multiple guide RNAs to control for off-target effects

  • Phenotypic Analysis Pipeline:

    • Implement hierarchical phenotyping from molecular to cellular to organismal levels

    • Use high-content imaging for sperm morphology and motility analysis

    • Combine with proteomics to identify compensatory mechanisms

For example, a comprehensive study might generate several ODF4 mutant lines targeting different domains, validate editing efficiency at genomic, transcript, and protein levels, and then analyze effects on sperm ultrastructure and function using electron microscopy and computer-assisted sperm analysis.

What methodological approaches can resolve contradictory findings about ODF4's role in male fertility?

When investigating contradictory findings regarding ODF4's role in fertility, implement this resolution framework:

  • Comparative Analysis of Methodological Differences:

    • Systematically catalog methodological variations across studies (species, techniques, measurements)

    • Assess study quality using standardized tools from methodological research

    • Identify potential sources of heterogeneity in results

  • Sequential Experimental Approach:

    • Begin with in vitro mechanistic studies to establish biochemical functions

    • Progress to cellular studies examining ODF4's role in sperm structure

    • Advance to organismal studies assessing fertility outcomes

    • Connect findings across levels to build a coherent functional model

  • Meta-Research Methods:

    • Conduct formal meta-analysis where sufficient comparable studies exist

    • Use sensitivity analyses to identify influential methodological factors

    • Consider Bayesian approaches to incorporate prior knowledge

This systematic approach transforms contradictions into research opportunities. For instance, species-specific differences in ODF4 function might reveal important evolutionary adaptations in sperm biology that would not be discovered without investigating the contradictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.