Recombinant Human Oxidized low-density lipoprotein receptor 1 (OLR1)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

OLR1/LOX-1 mediates pro-atherogenic processes through ligand binding and signaling:

Key Ligands

  • Oxidized LDL (oxLDL)

  • Advanced glycation end products (AGEs)

  • Apoptotic cells, bacteria, and heat shock proteins .

Cellular Effects

  • Endothelial dysfunction: Reduces nitric oxide (NO) production, increases reactive oxygen species (ROS), and upregulates adhesion molecules (e.g., VCAM-1) .

  • Foam cell formation: Facilitates oxLDL uptake in macrophages .

  • Apoptosis: Induces Bax/Bcl-2 imbalance in endothelial cells .

  • Plaque instability: Promotes matrix metalloproteinase (MMP) expression and macrophage apoptosis .

Regulation

  • Induced by TNF-α, IL-6, oxLDL, hypertension, and hyperglycemia .

LOXIN Isoform

A splice variant lacking exon 5 (LOXIN) antagonizes LOX-1-mediated apoptosis:

  • Function: Reduces oxLDL-induced macrophage apoptosis by 40–60% .

  • Genetic association: Non-risk OLR1 haplotypes correlate with higher LOXIN expression and reduced myocardial infarction risk .

FeatureLOX-1LOXIN
Exons1–61–4, 6
Lectin-like domainFull-lengthTruncated
LocalizationCell membraneIntracellular
Apoptotic effectPro-apoptoticAnti-apoptotic

Pharmacological Targeting

  • Antibodies: Anti-LOX-1 antibodies inhibit atherosclerosis progression in animal models .

  • Small molecules: Statins and antioxidants suppress LOX-1 expression .

Challenges and Future Directions

  • Stability: Soluble LOX-1 has a short half-life due to protease susceptibility .

  • Therapeutic development: Targeting LOX-1 requires isoform-specific strategies to avoid disrupting LOXIN’s protective effects .

  • Clinical trials: Anti-LOX-1 therapies are in preclinical stages .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
C-type lectin domain family 8 member A; CLEC8A; hLOX 1; hLOX-1; Lectin like oxidized LDL receptor 1; Lectin like oxLDL receptor 1; Lectin type oxidized LDL receptor 1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1; low density lipoprotein oxidized, receptor 1; LOX-1; LOXIN; Olr1; OLR1_HUMAN; Ox LDL receptor 1; Ox-LDL receptor 1; Oxidised low density lipoprotein (lectin like) receptor 1; Oxidized low density lipoprotein receptor 1; Oxidized low density lipoprotein receptor 1 soluble form; Oxidized low-density lipoprotein receptor 1; OxLDL receptor 1 ; SCARE1; Scavenger receptor class E, member 1; SLOX1; soluble form; SR-EI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Uniprot No.

Target Background

Function
Oxidized low-density lipoprotein receptor 1 (OLR1), also known as LOX-1, serves as a receptor mediating the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis, inducing activation and dysfunction in vascular endothelial cells, leading to pro-inflammatory responses, pro-oxidative conditions, and apoptosis. Its association with oxLDL triggers the activation of NF-kappa-B through increased production of intracellular reactive oxygen, resulting in various pro-atherogenic cellular responses, including reduced nitric oxide (NO) release, monocyte adhesion, and apoptosis. In addition to oxLDL binding, OLR1 functions as a receptor for the HSP70 protein, involved in antigen cross-presentation to naïve T-cells in dendritic cells, thus participating in cell-mediated antigen cross-presentation. OLR1 is also implicated in inflammatory processes, acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. It also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria.
Gene References Into Functions
  1. Studies have shown that high LOX-1 expression is associated with poor prognosis in gastric cancer (GC) patients and TNM stage. LOX-1 was found to promote migration, invasion, and epithelial-mesenchymal transition (EMT) of GC cells by activating the PI3K/Akt/GSK3beta pathway. PMID: 28345638
  2. LOX-1(+) CD15(+) polymorphonuclear myeloid-derived suppressor cells were elevated in hepatocellular carcinoma patients and suppressed T cell proliferation through the ROS/Arg I pathway induced by ER stress. PMID: 29211299
  3. High LOX-1 ligand activity has been identified as a risk factor for ischemic stroke. PMID: 28442661
  4. Analysis revealed that OLR1 is not required for the transcriptional regulation induced by oxidized PAPC. However, OLR1 knockdown affected the expression of CNN2, HMRR, ITGB6, and KIF20A, genes governing cell proliferation and motility. PMID: 29103984
  5. Data indicate that oxidized low density lipoprotein receptor 1 (LOX-1) is overexpressed in prostate cancer cells. PMID: 29107109
  6. Expression of OLR1 is significantly higher in the arterial wall of epicardial coronary arteries compared to intramyocardial coronary arteries. PMID: 29448251
  7. Let7g exerts an antiaging effect on endothelial cells, independent of LOX1. PMID: 29393358
  8. High LOX-1 expression in pancreatic cancer tissues is indicative of the occurrence of lymph node metastases, high TNM stages, and a poor prognosis. PMID: 29168159
  9. LincRNAp21 is a major mediator of oxLDLinduced apoptosis and expression of LOX1 in human vascular endothelial cells, and it acts via activation of PKCdelta. PMID: 28983628
  10. This study demonstrates that LOX-1 is involved in IL-1beta production and extracellular matrix breakdown in dental peri-implantitis. PMID: 28898769
  11. Results showed that the scFv with N-terminal fusing peptides proteins exhibited increased LOX-1-binding activity without compromising stability. These findings contribute to enhancing the application efficacy of LOX-1 targeting scFv in LOX-1-based therapy. PMID: 29094051
  12. The serum sLOX-1 level was higher in patients with large artery atherosclerotic stroke, and it was an independent predictor of functional outcome in patients with large artery atherosclerotic ischemic stroke. PMID: 27967338
  13. LOX-1 plays a role in atherogenesis and tumorigenesis, potentially serving as a link between these diseases [review]. PMID: 29462603
  14. The rs1050283 T allele of LOX-1 is strongly associated with an increased risk for atherosclerotic cerebral infarction in a Chinese population, which also affects levels of LOX-1 and sLOX-1. PMID: 27840386
  15. Data revealed that miR-let-7g exhibits anti-atherosclerotic activity, at least partially by targeting the LOX-1 signaling pathway. PMID: 28535009
  16. High LOX1 expression is associated with colorectal cancer. PMID: 26895376
  17. Increased LOX-1 expression in endothelial cells is potentially involved in the pathogenesis of sickle cell disease vasculopathy. PMID: 27519944
  18. LOX-1 signaling and its crucial role in cytokine interactions. PMID: 28860004
  19. High OLR1 expression is associated with breast cancer. PMID: 28844714
  20. Multiple classical molecular dynamics simulations have been applied to the human LOX-1 receptor to clarify the role of the Trp150Ala mutation in the loss of binding activity. Results indicate that the substitution of this crucial residue, located at the dimer interface, markedly disrupts the wild-type receptor dynamics. PMID: 28657156
  21. Carrying the C allele of the rs11053646 variant of the OLR1 gene was associated with an increased risk of CAD in heterozygous adult patients with FH. This risk could be even greater in smokers and younger patients. PMID: 28941610
  22. Berberine could prevent the oxLDL and TNFalpha - induced LOX1 expression and oxidative stress, key events that lead to NOX, MAPK/Erk1/2, and NF-kappaB activation linked to endothelial dysfunction. PMID: 28511903
  23. Individuals aged 30 years or older with abdominal obesity presented lower Lox1 levels than those aged 30 years or older without abdominal obesity. PMID: 27525284
  24. These studies suggest that activation of LOX-1 expression occurs through binding of the chlamydial glycan and provides one mechanism by which Chlamydia pneumoniae infection could contribute to the pathogenesis of atherosclerosis. PMID: 23821487
  25. Elevated LOX1 is associated with acute stroke. PMID: 27025681
  26. Xanthine oxidase induces foam cell formation largely through activation of the LOX-1 - NLRP3 pathway in both vascular smooth muscle cells and THP-1 cells. PMID: 28084571
  27. Studies show that MiR-590-5p inhibits angiogenesis by targeting LOX-1 and suppressing redox-sensitive signals. PMID: 26932825
  28. The OLR1 rs1050286 SNP may contribute to modifying OLR1 susceptibility to acute myocardial infarction and coronary artery diseases. PMID: 26542080
  29. Serum sLOX-1 level was significantly lower in the restless legs syndrome patient group compared to controls. PMID: 27546362
  30. The mechanistic link between miR-590-5p and LOX-1: miR-590-5p downregulation led to LOX-1 upregulation in endothelial cells. PMID: 26906623
  31. Serum LAB was associated with an increased carotid IMT in Japanese men, particularly those with hypercholesterolemia. PMID: 26892134
  32. The current meta-analysis highlighted that variant alleles of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke. PMID: 26666837
  33. Silencing of LOX-1 gene expression abolished ox-LDL induced effects on cell viability, reactive oxygen species generation, and gene expression. PMID: 26510581
  34. Both the 501>C single nucleotide polymorphisms in the LOX1 gene and the serum LOX1 level may be used to predict the development of left ventricular hypertrophy among essential hypertension patients. PMID: 24480971
  35. For our Turkish sample group, LOX-1 30UTR188C/T and K167N polymorphisms may not be involved in susceptibility to GDM [gestational diabetes mellitus]. PMID: 26296941
  36. Cholesterol depletion triggers the release of LOX-1 in exosomes as a full-length transmembrane isoform and as a truncated ectodomain soluble fragment. PMID: 26495844
  37. Interaction between Lox-1, C-reactive protein, and oxidized LDL plays a role in the pathogenesis of atherosclerosis. PMID: 26607724
  38. OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells. PMID: 26305474
  39. Ginkgo biloba extract inhibits oxLDL-induced matrix metalloproteinase activation by modulating the LOX1-regulated signaling pathway in human umbilical vein endothelial cells. PMID: 25080882
  40. Data show that the interplay between the two TNF receptors (TNFR1 and TNFR2) was apparent in the expression pattern of lectin-type oxidized LDL receptor 1 (LOX-1) in response to TNF-alpha. PMID: 25416967
  41. The serum LOX-1 levels were significantly higher in NAFLD patients than in healthy controls. PMID: 26185381
  42. Low shear stress is a regulator of autophagy, and LOX-1 plays a significant role in shear stress-induced autophagy. PMID: 25697875
  43. Results showed higher expression of HSP70 and LOX-1 in the placental tissues of pre-eclampsia patients, suggesting the possible contribution of these molecules to the disease pathogenesis. PMID: 24786389
  44. Elevated plasma sLOX-1 level on admission independently predicts long-term all-cause mortality and MACE after STEMI. PMID: 25746549
  45. A biomarker for determining early endothelial damage in hypertension, particularly in white coat hypertension. PMID: 25007999
  46. LOX-1 activation by oxLDL is a crucial event that enhances tumor angiogenesis. PMID: 25170920
  47. LOX-1 is the receptor mediating oxidized LDL activity in vascular endothelial cells. Activation of LOX-1 causes endothelial dysfunction and vascular lipid deposition. PMID: 25463747
  48. Our data suggest a new direction for LOX-1 regulation through modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism. PMID: 25982096
  49. The present study showed that circulating soluble LOX-1 originates from coronary circulation, and soluble LOX-1 and LOX-1 index are valuable biomarkers for acute coronary syndrome. PMID: 24895597
  50. Meta-analysis results showed that the +1073 C/T polymorphism in ORL1 decreased the risk of Alzheimer's disease. This allele was predicted to affect the binding site of many miRNAs, explaining the relationship between the +1073 C/T variant and the disease. PMID: 25501227

Show More

Hide All

Database Links

HGNC: 8133

OMIM: 602601

KEGG: hsa:4973

STRING: 9606.ENSP00000309124

UniGene: Hs.412484

Involvement In Disease
Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility.; DISEASE: Note=OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not.
Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted. Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation.
Tissue Specificity
Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate

Q&A

What is the functional significance of OLR1 in normal physiology versus pathological conditions?

OLR1, a class E scavenger receptor, functions as a transmembrane glycoprotein that primarily mediates the uptake and internalization of oxidized low-density lipoprotein (oxLDL) . Under normal physiological conditions, OLR1 maintains relatively low expression levels but becomes significantly upregulated in response to various stimuli.

In pathological scenarios, OLR1 expression can be induced by multiple factors including:

  • Oxidative stress and inflammatory cytokines

  • oxLDL exposure

  • Proatherogenic stimuli such as diabetes mellitus

  • Hyperlipidemia and hypertension

The upregulation of OLR1 in disease states contributes to several pathological processes. In cancer, elevated OLR1 expression has been linked to more aggressive and metastatic characteristics . In the cardiovascular system, increased OLR1 activity contributes to endothelial cell activation, dysfunction, apoptosis, and impaired vasorelaxation, which collectively promote atherosclerosis development and progression .

What experimental models are most suitable for studying OLR1 in different disease contexts?

For studying OLR1, researchers should select models based on specific disease contexts:

In Cancer Research:

  • Cell lines: Multiple human cancer cell lines demonstrate variable OLR1 expression. Verification studies have utilized BEAS-2B (normal lung epithelial cells) alongside cancer lines including NCI-H460, PLA-801D, A549, HCC827, NCI-H1299, and NCI-H661 to establish baseline expression profiles .

  • Patient-derived samples: Primary tumor samples from patients with HNSCC have been effectively used to evaluate the co-expression pattern of OLR1 and CD68 on macrophages through histological examination .

  • Bioinformatic datasets: The Cancer Genome Atlas (TCGA) provides valuable resources for analyzing OLR1 expression across 498 HNSCC tumor samples compared to adjacent normal tissues .

In Cardiovascular Research:

  • Patient cohorts: Carefully selected subjects undergoing coronary angiography and left ventriculography, with controls having no angiographically demonstrable coronary lesions, represent optimal study populations .

In Neurological Research:

  • Case-control studies: Research on Alzheimer's disease has employed large cohorts (984 LOAD cases and 1,354 healthy controls) to investigate potential associations between OLR1 polymorphisms and disease onset .

What are the standard techniques for detecting and quantifying OLR1 expression?

Multiple complementary techniques should be employed for comprehensive OLR1 characterization:

Transcriptional Analysis:

  • Single-cell RNA-sequencing (scRNA-seq) has proven valuable for identifying cell-specific expression patterns of OLR1, particularly in heterogeneous tissues like tumors .

  • qRT-PCR can be used for targeted expression analysis in cell lines and tissue samples.

Protein Detection:

  • Immunohistochemistry with co-staining approaches (e.g., OLR1 and CD68) allows visualization of protein co-expression patterns in tissue sections .

  • Western blotting provides quantitative assessment of OLR1 protein levels.

  • Flow cytometry enables cell-specific detection of membrane-bound OLR1.

Genetic Analysis:

  • SNP genotyping for specific polymorphisms (e.g., rs1050283, rs1050286, rs17808009) can be performed using standard PCR-based methods .

How does OLR1 expression on tumor-associated macrophages influence the tumor microenvironment?

OLR1 expression on tumor-associated macrophages (TAMs) represents a critical immunomodulatory mechanism within the tumor microenvironment (TME). Recent single-cell RNA-sequencing analysis of head and neck squamous cell carcinoma (HNSCC) demonstrated that OLR1 expression is specifically enriched on TAMs . This finding has important implications for understanding tumor progression and patient outcomes.

Mechanistically, OLR1-expressing TAMs appear to contribute to an immunosuppressive TME. The presence of these OLR1+ macrophages correlates with inferior prognosis in HNSCC patients, suggesting they promote tumor growth rather than anti-tumor immunity . This aligns with the understanding that TAM-dominated microenvironments in HNSCC generally predict worse clinical outcomes.

Visualization of OLR1 expression within tumor tissues reveals a consistent co-expression pattern with CD68 (a pan-macrophage marker) in primary HNSCC samples, confirming the macrophage-specific localization of OLR1 . This spatial distribution further supports the functional relationship between OLR1 and immunosuppressive macrophage phenotypes.

Researchers investigating this relationship should employ dual immunohistochemistry staining for both OLR1 and macrophage markers, combined with functional assays to assess the impact of OLR1 inhibition on macrophage polarization and subsequent tumor progression.

What is the prognostic value of OLR1 expression in cancer, and how can this be assessed methodologically?

OLR1 expression demonstrates significant prognostic value across multiple cancer types, particularly in HNSCC and NSCLC. Methodologically, researchers should consider the following approaches to assess its prognostic significance:

In NSCLC:
OLR1 expression correlates with immune cell infiltration patterns and may predict immunotherapy response. Using the TIDE computational framework, researchers found that among samples with the highest OLR1 expression, 54% (27/50) were predicted to respond to immune checkpoint blockade therapy, compared to only 32% (16/50) in the low expression group .

Methodological Approach:
For optimal prognostic assessment, researchers should:

  • Establish clear expression thresholds through quantitative analysis

  • Conduct Kaplan-Meier survival analyses with appropriate statistical testing

  • Perform multivariate analyses to control for confounding factors

  • Validate findings across independent cohorts to ensure reproducibility

How do OLR1 genetic polymorphisms correlate with disease susceptibility, and what are the best methodological approaches to investigate these associations?

The relationship between OLR1 genetic polymorphisms and disease susceptibility reveals complex patterns across different populations and conditions. When investigating these associations, researchers should employ rigorous methodological approaches to navigate the inherent challenges of genetic association studies.

Disease-Specific Polymorphism Patterns:

In Alzheimer's Disease:

In Cardiovascular Disease:

Methodological Recommendations:

  • Sample Selection and Characterization:

    • Ensure precise phenotypic characterization of cases and controls

    • For cardiovascular studies, utilize coronary angiography and left ventriculography to definitively characterize subjects

    • Maintain strict inclusion/exclusion criteria to minimize heterogeneity

  • Statistical Considerations:

    • Calculate required sample sizes based on anticipated effect sizes

    • Account for multiple testing through appropriate correction methods

    • Consider ethnicity-specific effects and stratify analyses accordingly

  • Validation Strategies:

    • Replicate findings in independent cohorts

    • Employ functional studies to validate the biological significance of identified polymorphisms

    • Consider meta-analysis approaches to integrate findings across multiple studies

  • Technical Approaches:

    • Utilize high-throughput genotyping platforms for comprehensive coverage

    • Consider haplotype analysis rather than focusing solely on individual SNPs

    • Integrate genomic data with other -omics approaches for more comprehensive understanding

How can OLR1 expression be leveraged as a biomarker for immunotherapy response in cancer treatment?

OLR1 shows significant potential as a predictive biomarker for immunotherapy response, particularly in NSCLC. Researchers investigating this application should consider several methodological aspects:

Predictive Value Assessment:
Using the TIDE computational framework, which evaluates tumor immune escape potential, researchers found that samples with high OLR1 expression demonstrated significantly higher predicted response rates to immune checkpoint blockade therapy compared to those with low expression (54% vs. 32%) .

Correlation with Established Biomarkers:
OLR1 expression shows moderately strong correlations with four established immunotherapy biomarkers:

  • PD-L1 (immune checkpoint molecule)

  • CD8A (cytotoxic T cell marker)

  • GZMB (cytolytic activity marker)

  • NOS2 (immunomodulatory enzyme)

These correlations support OLR1's potential role in the immunotherapy response pathway.

Methodological Approach for Biomarker Validation:

  • Employ multiparametric flow cytometry or multiplex immunohistochemistry to simultaneously assess OLR1 and immune cell markers

  • Correlate OLR1 expression with clinical outcomes in patients receiving immunotherapy

  • Develop standardized cutoff values for defining "high" versus "low" OLR1 expression

  • Validate findings across multiple independent cohorts

What are the primary contradictions in current OLR1 research, and how should researchers address these discrepancies?

Current OLR1 research presents several notable contradictions that researchers must address through methodological rigor and contextual interpretation:

Disease Association Discrepancies:

Methodological Approaches to Address Contradictions:

  • Population Stratification:

    • Consider genetic heterogeneity across different ethnic groups

    • Ensure adequate sample sizes within each stratified population

    • Employ population-specific control groups

  • Phenotypic Precision:

    • Develop standardized disease definitions and patient characterization protocols

    • Implement rigorous inclusion/exclusion criteria

    • Consider disease subtypes that may respond differently to genetic influences

  • Statistical Considerations:

    • Conduct power analyses to ensure adequate statistical power

    • Implement appropriate multiple testing corrections

    • Consider metaanalysis approaches to integrate findings across studies

  • Functional Validation:

    • Move beyond association studies to establish functional relevance

    • Employ in vitro and in vivo models to validate molecular mechanisms

    • Integrate multi-omics approaches to establish biological context

What are the optimal experimental controls when studying OLR1 in different disease models?

When designing experiments to study OLR1, researchers must implement rigorous control strategies tailored to specific disease contexts:

In Cancer Research:

  • Cell Line Controls:

    • Include both normal epithelial cells (e.g., BEAS-2B) and cancer cell lines with varying OLR1 expression levels (e.g., NCI-H460, A549, HCC827)

    • Implement OLR1 knockdown/overexpression controls to establish causality

  • Tissue Sample Controls:

    • Utilize paired tumor-adjacent normal tissues from the same patient

    • Include tissue microarrays with graduated expression levels

    • Employ isotype controls for immunohistochemistry experiments

  • Animal Model Controls:

    • Compare wild-type with OLR1 knockout models

    • Include sham-treated controls alongside experimental interventions

    • Utilize genetic background-matched controls for transgenic models

In Cardiovascular Research:

  • Patient Selection Controls:

    • Implement strict inclusion/exclusion criteria

    • Ensure controls are without any angiographically demonstrable coronary lesions and no evidence of active myocardial ischemia

    • Match cases and controls for key demographic and clinical parameters

  • Experimental Controls:

    • Include positive controls (known cardiovascular risk factors)

    • Implement technical replicates to ensure reproducibility

    • Consider time-course experiments to capture dynamic changes

How can researchers effectively assess the functional significance of OLR1 polymorphisms?

Assessing the functional significance of OLR1 polymorphisms requires a multi-level experimental approach:

Sequence-Based Analysis:

  • Utilize bioinformatic tools to predict functional effects on:

    • Protein structure and function

    • mRNA stability and processing

    • Transcription factor binding

    • miRNA binding sites, particularly for 3'UTR variants (e.g., rs1050283, rs1050286, rs17808009)

Expression Studies:

  • Implement reporter gene assays with wild-type and variant sequences

  • Assess allele-specific expression using primer extension assays

  • Quantify mRNA and protein expression levels in tissues or cells carrying different genotypes

Functional Cellular Assays:

  • Evaluate oxLDL binding and uptake in cells expressing different OLR1 variants

  • Assess downstream signaling pathway activation

  • Measure cellular phenotypes (e.g., apoptosis, inflammation) relevant to disease pathogenesis

In Vivo Validation:

  • Generate knock-in models expressing specific human polymorphisms

  • Assess disease-relevant phenotypes in these models

  • Implement tissue-specific expression systems to isolate effects

This comprehensive approach enables researchers to establish causality between genetic variation and functional outcomes, moving beyond simple association studies to mechanistic understanding.

What bioinformatic approaches are most effective for analyzing OLR1 expression across different datasets?

Researchers studying OLR1 should employ a range of bioinformatic methods to extract meaningful insights from expression data:

For Single-Cell Analysis:

  • Implement clustering algorithms to identify cell populations with differential OLR1 expression

  • Utilize t-SNE or UMAP dimensionality reduction to visualize cell distribution patterns

  • Apply trajectory analysis to understand developmental or state-transition relationships

For Bulk Tissue Analysis:

  • Employ ESTIMATE algorithm to infer tumor purity and immune/stromal cell infiltration

  • Utilize CIBERSORT for deconvolution of cell type-specific contributions to bulk expression

  • Implement differential expression analysis using limma or similar tools to identify OLR1-associated gene signatures

For Clinical Correlation:

  • Apply survival analysis methods (Kaplan-Meier, Cox regression) to assess prognostic significance

  • Implement predictive modeling approaches (TIDE framework) to estimate treatment response probabilities

  • Utilize nomogram development for integrating multiple predictive factors

For Multi-Omics Integration:

  • Correlate OLR1 expression with methylation, mutation, and copy number data

  • Implement network analysis to identify functional interaction partners

  • Utilize pathway enrichment approaches to contextualize biological significance

When implementing these approaches, researchers should be aware of potential limitations: "As the main disadvantage of data mining study, there are number of limitations of the work. In this study, all analyses used the same data set and all data was from gene expression micro-assay. The single source of data might affect the reliability of the results" .

How should researchers interpret contradictory findings regarding OLR1 in different disease contexts?

When confronted with contradictory findings about OLR1 across different disease contexts, researchers should implement a structured interpretative framework:

Contextual Factors to Consider:

  • Population Differences:

    • Genetic background may influence associations (e.g., OLR1 polymorphisms showing association with AD in Caucasians but not in Han Chinese)

    • "These discrepancies could be owing to an ascertainment difference, or to a population difference, or to the sample size reported in some of the published studies"

  • Disease Heterogeneity:

    • Even within a single disease classification, subtypes may demonstrate different relationships with OLR1

    • For example, OLR1 polymorphisms may have different associations with different forms of cardiovascular disease

  • Methodological Variations:

    • Differences in experimental design, sample processing, or analytical approaches may generate apparent contradictions

    • "Accuracy in the definition of the phenotype of patients and the clinical (and even the subclinical status) of controls is, therefore, crucial in these studies"

Integrative Interpretation Strategies:

  • Systematic Review Approach:

    • Compile all available evidence using systematic search strategies

    • Evaluate methodological quality of each study

    • Weight findings based on study design, sample size, and quality

  • Meta-Analysis:

    • When possible, quantitatively integrate findings across multiple studies

    • Perform subgroup analyses to identify patterns in contradictions

  • Biological Plausibility Assessment:

    • Evaluate contradictory findings in light of known biological mechanisms

    • Consider whether different contexts might logically produce different outcomes

  • Translational Perspective:

    • Consider whether contradictions might actually represent context-specific effects that could inform personalized medicine approaches

    • Develop testable hypotheses to resolve apparent contradictions

How can OLR1 targeting be integrated into combination immunotherapy strategies?

The emerging role of OLR1 in modulating the tumor immune microenvironment suggests significant potential for therapeutic targeting in combination immunotherapy strategies:

Rationale for OLR1 Targeting:

  • OLR1 expression on tumor-associated macrophages correlates with immunosuppressive microenvironments

  • High OLR1 expression correlates with increased predicted response to immune checkpoint blockade (54% vs. 32%)

  • OLR1 shows strong correlations with established immunotherapy biomarkers including PD-L1, CD8A, GZMB, and NOS2

Combination Strategy Design:

  • Sequencing Approaches:

    • Investigate whether OLR1 inhibition prior to checkpoint blockade might enhance efficacy

    • Explore concurrent vs. sequential administration protocols

    • Establish optimal dosing schedules through preclinical modeling

  • Cell-Specific Targeting:

    • Develop TAM-specific delivery systems for OLR1-targeting agents

    • Engineer bispecific antibodies targeting both OLR1 and other immunomodulatory molecules

    • Investigate the impact of OLR1 inhibition on specific immune cell subsets and their function

  • Biomarker-Guided Patient Selection:

    • Implement OLR1 expression as a stratification factor in clinical trials

    • Develop combinatorial biomarker panels incorporating OLR1 and other predictive markers

    • Utilize real-time monitoring of OLR1 expression to guide treatment decisions

Experimental Models for Combination Testing:

  • Syngeneic mouse models with humanized immune systems

  • Patient-derived xenografts with human immune cell reconstitution

  • Ex vivo tumor slice cultures maintaining original tumor architecture and immune context

What is the role of OLR1 in the interplay between metabolic disorders and cancer risk?

The dual involvement of OLR1 in metabolic regulation and cancer progression suggests a mechanistic link between these conditions that warrants deeper investigation:

Current Understanding:

  • OLR1 mediates the uptake and internalization of oxidized low-density lipoprotein (oxLDL)

  • Metabolic conditions including diabetes mellitus, hyperlipidemia, and hypertension induce OLR1 expression

  • OLR1 expression is associated with more aggressive and metastatic characteristics in multiple cancers

Research Approaches:

  • Epidemiological Studies:

    • Conduct large-scale analyses of cancer incidence in patients with metabolic disorders with OLR1 polymorphism stratification

    • Implement Mendelian randomization studies to establish causality

    • Develop risk prediction models incorporating metabolic parameters and OLR1 genetic variants

  • Mechanistic Investigations:

    • Explore how metabolic alterations influence OLR1 expression in pre-malignant tissues

    • Investigate whether OLR1-mediated lipid uptake alters cancer cell metabolism and growth

    • Elucidate the role of OLR1 in linking obesity-associated inflammation with cancer development

  • Intervention Studies:

    • Test whether metabolic interventions (diet, exercise, pharmacological) affect OLR1 expression in at-risk tissues

    • Assess whether OLR1 inhibition can mitigate cancer risk in metabolic disorder models

    • Evaluate the impact of combined metabolic and OLR1-targeting approaches

This research direction has significant translational potential, as understanding the OLR1-mediated link between metabolic disorders and cancer could inform preventive strategies and therapeutic approaches for patients with metabolic conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.