Recombinant Human P2Y purinoceptor 12 (P2RY12)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human P2Y purinoceptor 12 (P2RY12) is a genetically engineered form of the P2RY12 receptor, a G protein-coupled receptor (GPCR) critical for platelet activation and aggregation. This receptor binds adenosine diphosphate (ADP) and couples to Gαi proteins, inhibiting adenylyl cyclase and modulating downstream signaling pathways essential for hemostasis and thrombosis . Recombinant versions are produced in heterologous expression systems (e.g., E. coli, insect cells) for research and therapeutic development .

Signaling Mechanisms

P2RY12 activation by ADP triggers:

  1. Gαi Coupling: Inhibition of cAMP production, promoting platelet aggregation .

  2. PI3K Activation: Sustains platelet activation via Rap1b signaling .

Trafficking Dynamics

  • Internalization: Clathrin-mediated endocytosis regulated by GRK and arrestin .

  • Recycling: Dependent on the PDZ motif (ETPM); mutations (e.g., P341A) disrupt recycling, impairing receptor resensitization .

Functional PropertyImpact of PDZ Motif Disruption
Internalization EfficiencyReduced by 40–60% in P341A mutants
Recycling CapacityBlocked, leading to intracellular retention

Drug Development

  • Antiplatelet Therapies: Target for clopidogrel, ticagrelor, and prasugrel .

  • Structure-Activity Studies: Crystal structures guide design of novel antagonists .

Disease Models

  • Thrombotic Disorders: Used to study dysregulated platelet activation .

  • Neuroinflammation: Microglial P2RY12 influences neuroprotection and pathology in Alzheimer’s disease and multiple sclerosis .

PDZ Motif Mutations

  • P341A Mutation: Identified in a patient with bleeding diathesis, causing reduced surface receptor expression and impaired recycling .

  • Trafficking Defects: Mutant receptors accumulate in endosomal compartments, disrupting platelet responsiveness .

Reconstitution Studies

  • G Protein Specificity: Couples preferentially to Gαi2 in lipid vesicles, with EC₅₀ = 80 nM for 2MeSADP .

  • Antagonist Profiling: ATP acts as a low-affinity antagonist (IC₅₀ >100 μM) .

Clinical Relevance

  • Cardiovascular Disease: P2RY12 inhibitors reduce thrombotic events in acute coronary syndromes .

  • Microglial Dysfunction: Altered P2RY12 expression correlates with neuroinflammatory conditions .

Challenges and Future Directions

  • Expression Optimization: Improving yield and post-translational modifications in eukaryotic systems .

  • Mutation Screening: Identifying novel PDZ motif variants linked to bleeding disorders .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer, containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder formats.
Note: We prioritize shipping the format currently in stock. However, if you have specific format preferences, please indicate them during order placement. We will fulfill your requirements to the best of our ability.
Lead Time
Generally, we can dispatch your order within 1-3 working days of receipt. Delivery times may vary based on the purchasing method and destination. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is desired, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal storage, working aliquots should be kept at 4°C for up to one week.
Shelf Life
The shelf life of our products is dependent on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months when stored at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months when stored at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
P2RY12; HORK3; P2Y purinoceptor 12; P2Y12; ADP-glucose receptor; ADPG-R; P2T(AC; P2Y(AC; P2Y(cyc; P2Y12 platelet ADP receptor; P2Y(ADP; SP1999
Datasheet & Coa
Please contact us to get it.
Expression Region
1-342aa
Mol. Weight
42.2 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
P2Y purinoceptor 12 (P2RY12) serves as a receptor for ADP and ATP, coupled to G-proteins. It inhibits the adenylyl cyclase second messenger system and is not activated by UDP or UTP. This receptor plays a critical role in normal platelet aggregation and blood coagulation.
Gene References Into Functions
  1. Downregulation of the P2Y12 receptor in the superior cervical ganglia after myocardial ischemia may contribute to improved cardiac function by mitigating the sympathoexcitatory reflex. PMID: 28949406
  2. TRAP-6 induced platelet activation leads to an increase in purinergic receptor P2Y12 expression. PMID: 29902630
  3. Upon platelet activation with ADP, the number of GP IIb-IIIa and P2Y12 receptors increases, suggesting that these proteins are synthesized within activated platelets. PMID: 27028818
  4. In individuals with type 2 diabetes, the presence of chronic kidney disease is associated with hyperreactive platelets and impaired P2Y12 receptor signaling pathway function. PMID: 27786340
  5. Our research reveals a distinct impact of CYP2C19 and P2Y12 receptor polymorphisms on platelet reactivity and cardiovascular outcomes in coronary artery disease patients undergoing percutaneous coronary intervention while receiving clopidogrel treatment. Notably, heightened platelet reactivity negatively affects cardiovascular outcomes independently of the studied polymorphisms. PMID: 28329746
  6. Our findings provide insight into the positive regulation of Akt signaling through P2Y12 phosphorylation and MAPK signaling in platelets by ASK1. PMID: 28753204
  7. A genomic association study identified deleterious rare variants in P2RY12 among patients with ischemic stroke. PMID: 29232918
  8. Expression of platelet hsa-miR-223 increased and P2RY12 mRNA decreased in type 2 diabetic patients following ET non-significantly. PMID: 29526844
  9. A meta-analysis indicates a potential association between P2RY12 gene polymorphisms and an elevated risk of composite ischemic events in coronary artery disease patients treated with clopidogrel. [review] PMID: 29510176
  10. CLEC-2 and P2Y12 are essential for CpG ODN-induced platelet activation and thrombosis, suggesting that targeting these receptors could be a strategy for preventing adverse events in at-risk individuals. PMID: 28296036
  11. miR-223, miR-26b, miR-126 and miR-140 are expressed at lower levels in platelets and megakaryocytes in type 2 diabetics, resulting in up-regulation of P2RY12 and SELP mRNAs, which may contribute to adverse platelet function. PMID: 27975100
  12. The DHA - naringenin hybrid demonstrated triple antiplatelet activity by simultaneously targeting PAR-1, P2Y12 and COX-1 platelet activation pathways. PMID: 28844979
  13. The research suggests that P2Y12 is a valuable marker for identifying human microglia throughout the lifespan. Moreover, P2Y12 expression might help to differentiate activated microglia and infiltrating myeloid cells from quiescent microglia in the human CNS. PMID: 27862351
  14. P2RY12, the gene associated with thrombogenesis, exhibited differential expression between the left atrium and right atrium in sinus rhythm and atrial fibrillation. This suggests that changes in the expression of these genes are likely involved in the pathophysiology of AF-related thrombus formation. PMID: 27494721
  15. Abnormalities in the P2Y12 receptor, including congenital deficiencies or heightened activity in conditions like diabetes mellitus and chronic kidney disease, can increase the risk of prothrombotic states. (Review) PMID: 27628007
  16. Data indicates that PAR4 and P2Y12 heterodimer internalization/endocytosis is crucial for beta-arrestin-2 recruitment to endosomes and the up-regulation of Akt signaling. While activation of PAR4, but not P2Y12, drives internalization of the PAR4-P2Y12 heterodimer. (PAR4 = protease-activated receptor 4; P2Y12 = purinergic receptor P2Y, G-protein coupled, 12 protein; Akt = proto-oncogene protein c-akt) PMID: 28652403
  17. Research suggests that purinergic receptor P2Y12 (P2Y12 receptor) gene C34T and G52T polymorphism could be a risk factor for suboptimal platelet response in patients undergoing clopidogrel therapy. PMID: 28791856
  18. Studies describe two novel modes of action for ticagrelor: inhibition of platelet ENT1 and inverse agonism at the P2Y12R. These actions contribute to its effective inhibition of platelet activation. PMID: 27694321
  19. Beyond the established association of the CYP2C19 *2 and *3 LOF alleles with high on-treatment platelet reactivity (HTPR), haplotypes of P2RY12 rs6798347, rs6787801, rs6801273, and rs6785930, rather than rs2046934 (T744C) linked to the pharmacodynamics of clopidogrel in patients with ACS, were independently associated with HTPR. PMID: 28070995
  20. This report provides an update on dysfunctional platelet P2Y12R mutations diagnosed in individuals with congenital lifelong bleeding problems. [review] PMID: 27487748
  21. The study aimed to evaluate the effects of platelet receptor gene (P2Y12, P2Y1) and glycoprotein gene (GPIIIa) polymorphisms, as well as their interactions, on antiplatelet drug responsiveness and clinical outcomes in patients with acute MIS. PMID: 28091702
  22. The Conundrum of Platelet P2Y12 Inhibition in ST-Segment Elevation Myocardial Infarction. PMID: 27795489
  23. P2Y12R gene rs2046934 C>T and rs3732759 A>G polymorphisms may be associated with the risk of coronary artery disease and the effectiveness of clopidogrel treatment for CAD. PMID: 27566695
  24. No association was found between genotype frequencies of P2Y12 and responsiveness to clopidogrel in coronary heart disease patients of Han ethnicity. PMID: 27488401
  25. P2Y12 inhibitor monotherapy and dual antiplatelet therapy effectively inhibit hemostatic system activation to a comparable extent in healthy volunteers. PMID: 26663880
  26. In individuals with the loss of function C34T polymorphism of the P2Y12 receptor, smoking is associated with increased adverse cardiovascular outcomes in coronary artery disease patients. PMID: 26950170
  27. These data strongly suggest that P2Y12 may be a significant pharmacological target for treating patients with allergic bronchial asthma. [review] PMID: 25579761
  28. This report recommends an appropriate P2Y12 inhibitor regimen to prevent increased bleeding risk while maintaining antiplatelet efficacy in East Asian patients with acute coronary syndrome, specifically focusing on Korean patients. PMID: 26354056
  29. Baseline platelet aggregation was elevated in carriers of common alleles of P2Y12 SNPs rs1907637, rs2046934, and rs6809699, as well as rs6787801 TC heterozygotes. PMID: 26083990
  30. The ratio of ADP- to TRAP-induced platelet aggregation effectively quantifies P2Y12-dependent platelet inhibition independent of platelet count, in contrast to conventional ADP-induced aggregation. PMID: 26885820
  31. Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 rapidly attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation regardless of concomitant aspirin therapy. PMID: 26743169
  32. PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents. PMID: 26870959
  33. In patients with non-ST elevation acute coronary syndrome undergoing PCI, a loading dose of ticagrelor or prasugrel administered during the procedure provides optimal P2Y12-ADP receptor blockade within 2 hours and maximum inhibition within 4 hours. PMID: 26311415
  34. While growing evidence suggests a cancer-protective effect of aspirin, this study indicates that P2Y12 inhibition may also play a role. PMID: 26353776
  35. The study establishes a reliable antiplatelet profile of SAR216471, supporting its potential clinical use as an alternative to currently available P2Y12 receptor antagonists. PMID: 25064036
  36. Two functional single nucleotide polymorphisms of the PON1 gene (rs662 and rs854560) and three variants of the P2RY12 gene (rs2046934, rs6798347, rs6801273) were investigated in pooled samples from the average Hungarian Roma and Hungarian populations. PMID: 25297118
  37. Coexisting polymorphisms of CYP3A5*3 and 2C19*2, but not P2Y12*1, play a significant role in the variability of clopidogrel's therapeutic effect. PMID: 25730082
  38. ADP stimulation of P2Y12 leads to a decrease in cAMP, which in turn, causes changes in phospholipase C phosphorylation by protein kinase A, an increase in cytoplasmic calcium levels, and subsequently, PS+ platelet formation. PMID: 26391841
  39. Leukotriene E4 may play important roles in allergic mucus secretion, potentially via activation of the P2Y12 receptor. PMID: 25838093
  40. The distribution of ABCB1, CYP3A5, CYP2C19, and P2RY12 gene polymorphisms differentiates the Mexican Mestizos population from other ethnic groups. PMID: 25106522
  41. Experiments reveal a surmountable and competitive mode of antagonism of ticagrelor at P2Y12 receptors activated by either the natural agonist ADP or the synthetic agonist 2-methylthio-ADP. PMID: 25186974
  42. This is the first study to demonstrate that genetic polymorphisms of P2RY12 can influence platelet and eosinophil activation in patients with aspirin-exacerbated respiratory disease following aspirin exposure. PMID: 25778862
  43. This is the first study to report that PJ34 could act via competitive P2Y(12) antagonism. PMID: 25329809
  44. Our findings suggest that regulating gpiibiiia and P2Y12 levels could be clinically useful for activating platelets to achieve hemostasis. PMID: 25247182
  45. The findings of this study suggest a potential association between P2Y12-receptor H2/H2 carriers and reduced platelet function mediated by TRAP in healthy volunteers. PMID: 24510678
  46. The study reports robust involvement of P2Y12R in inflammatory pain: the anti-hyperalgesic effect of P2Y12R antagonism could be mediated by the inhibition of both central and peripheral cytokine production, involving alpha7-receptor mediated efferent pathways. PMID: 24971933
  47. Two patients with bleeding diathesis exhibited dysfunctional platelet P2Y12 receptor for ADP, attributed to a homozygous His187Gln mutation. PMID: 25428217
  48. Thrombin activates the mTORC1 pathway in human platelets through PKC-mediated ADP secretion and subsequent activation of P2Y(12), in a manner largely independent of the canonical PI3 kinase/Akt pathway. PMID: 24612393
  49. Analysis of a P2Y12 receptor mutation and a function-reducing polymorphism in protease-activated receptor 1 in a patient with chronic bleeding. [case report] PMID: 24612435
  50. The evidence from our study indicates that P2Y12 methylation may offer new insights into the pathogenesis of CR. PMID: 24745016

Show More

Hide All

Database Links

HGNC: 18124

OMIM: 600515

KEGG: hsa:64805

STRING: 9606.ENSP00000307259

UniGene: Hs.591281

Involvement In Disease
Bleeding disorder, platelet-type 8 (BDPLT8)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.

Q&A

What is the molecular structure and function of P2RY12?

P2RY12 is a G-protein coupled receptor that plays a crucial role in hemostasis through its expression on platelets. The receptor structure includes seven transmembrane domains with an extracellular N-terminus and an intracellular C-terminus. A notable structural feature is the PDZ-binding motif (ETPM) at the extreme C-terminus, which is essential for proper receptor trafficking and function .

Functionally, P2RY12 couples to Gi proteins and, upon activation by ADP, inhibits adenylyl cyclase activity, leading to reduced intracellular cAMP levels. This signaling cascade is critical for platelet activation and aggregation. The receptor undergoes dynamic regulation through internalization and recycling processes that maintain receptor responsiveness, which is essential for normal platelet function .

Methodological approaches to study P2RY12 structure include:

  • Site-directed mutagenesis to identify functional domains

  • Expression of tagged receptor constructs in cell lines

  • Co-immunoprecipitation experiments to determine protein interaction partners

  • Ligand binding assays to assess receptor expression and affinity

What role does the PDZ-binding motif play in P2RY12 function?

The PDZ-binding motif (ETPM) at the C-terminus of P2RY12 is critical for proper receptor trafficking. Research has demonstrated that this motif regulates multiple aspects of receptor dynamics:

  • Receptor internalization: Studies show that deletion or mutation of this motif (e.g., P341A) significantly attenuates receptor internalization in response to agonist stimulation .

  • Recycling pathway: An intact PDZ-binding motif is essential for recycling of internalized receptors back to the cell surface. When this motif is compromised, receptors remain trapped in intracellular sorting compartments .

  • Arrestin interaction: The PDZ-binding motif facilitates interaction between P2RY12 and arrestin proteins (arrestin-2 and arrestin-3), which are required for clathrin-mediated endocytosis .

The physiological significance of this motif is highlighted by a clinical case study of a patient with a heterozygous P341A mutation in the PDZ-binding sequence who exhibited compromised P2RY12 recycling in platelets, demonstrating that even subtle alterations in this domain can affect receptor function .

What genetic variants of P2RY12 have been identified in human populations?

Several genetic variants in the P2RY12 gene have been identified through population studies, with significant implications for platelet function and response to antiplatelet therapies:

  • Common haplotypes: Studies have identified at least two common haplotypes (each with >20% frequency) that are associated with approximately 5% lower on-treatment platelet aggregation per haplotype allele when patients are treated with clopidogrel .

  • Single nucleotide polymorphisms (SNPs): Multiple SNPs have been identified throughout the P2RY12 gene, with some showing associations with platelet reactivity and clinical outcomes.

  • Functional mutations: The P341A mutation in the PDZ-binding motif is a specific example of a functional variant that affects receptor trafficking and expression on the platelet surface .

Research methodologies for studying P2RY12 genetic variants include:

  • Genotyping of patient cohorts using microarray or sequencing technologies

  • Association studies correlating genetic variants with platelet function measurements

  • In vitro expression of variant receptors to assess functional impacts

  • Development of knock-in mouse models carrying human variants

What are the molecular mechanisms underlying P2RY12 internalization and recycling?

P2RY12 internalization follows a complex pathway that involves several molecular interactions:

  • Agonist-induced activation: Upon ADP binding, P2RY12 undergoes conformational changes that promote interaction with regulatory proteins.

  • Arrestin recruitment: Research demonstrates that P2RY12 activation leads to rapid recruitment of arrestin-2 and arrestin-3 from cytosol to membrane in transfected cell lines . Before agonist stimulation, arrestin-2-GFP displays a diffuse cytoplasmic distribution, but after ADP addition, rapid translocation to the membrane occurs .

  • Clathrin-mediated endocytosis: P2RY12 internalizes through clathrin-mediated endocytosis in a GRK- and arrestin-dependent manner .

  • Sorting and recycling: After internalization, receptors enter endosomal sorting compartments and are either recycled back to the plasma membrane or targeted for degradation.

Experimental data shows that PDZ-binding motif mutants (P341A or E339stop) fail to recruit arrestins after agonist stimulation . Coimmunoprecipitation experiments confirmed that arrestin-2-GFP coprecipitates with wild-type P2RY12, but not with T320stop, E339stop, or P341A mutants after agonist addition .

Furthermore, overexpression of a dominant-negative mutant form of arrestin-2 selectively attenuated agonist-induced wild-type receptor internalization but had no effect on mutant receptor internalization . These findings establish that an intact PDZ ligand is required for arrestin/P2RY12 interaction and subsequent arrestin-dependent receptor internalization.

How does P2RY12 function in microglia compared to platelets?

P2RY12 serves distinct but related functions in platelets and microglia:

In platelets:

  • Functions as a primary receptor for ADP

  • Mediates platelet activation and aggregation

  • Undergoes dynamic regulation through internalization and recycling to maintain responsiveness

In microglia:

  • Serves as a nucleotide sensing metabotropic GPCR in the microglial "sensome"

  • Regulates morphological changes that microglia display in response to tissue damage or inflammation

  • Acts as a specific marker for parenchymal microglia in the brain

Transcriptional profiling studies using P2ry12-CreER with a conditionally expressed Rpl22-HA allele have identified distinct gene expression patterns in microglia compared to other CNS macrophages . P2RY12 is part of a cluster of genes preferentially expressed in microglia, including other P2Y family members such as Gpr34, P2ry13, and P2ry6 .

Experimental approaches to study P2RY12 in microglia include:

  • Genetic labeling using P2ry12-CreER knock-in mouse lines

  • Flow cytometry and immunohistochemistry to assess cell-specific expression

  • Ribosomal profiling to identify cell-specific transcriptional signatures

  • Functional assays to measure microglial responses to tissue damage

How do mutations in the PDZ-binding motif affect P2RY12 function in experimental models?

Experimental studies have extensively characterized how mutations in the PDZ-binding motif impact P2RY12 function:

  • Receptor construct studies: Analysis of C-tail deletion mutants (E339stop, T320stop, K303stop) and point mutations (P341A) has shown that:

    • These mutants express at the cell surface at comparable levels to full-length receptors (except K303stop)

    • Agonist-dependent activation of G proteins remains comparable to wild-type receptors

    • Total surface receptor loss after agonist exposure is significantly attenuated

    • Receptor recycling to the cell surface is completely blocked

  • Trafficking analysis: Immunofluorescence microscopy confirmed that variant receptors:

    • Do not recycle efficiently to the cell surface after internalization

    • Are retained in intracellular sorting compartments

    • In co-expression experiments, while wild-type receptors efficiently recycled back to the cell surface after agonist removal, E339stop and P341A variant receptors remained trapped intracellularly

  • Clinical relevance: A human subject with a heterozygous P341A mutation showed:

    • Reduced P2RY12 expression on platelet surfaces

    • Significantly compromised receptor recycling

These findings represent the first reported mutation in a PDZ ligand of an endogenously expressed protein leading to observable changes in protein trafficking, providing valuable confirmation of the physiological significance of PDZ-mediated pathways .

What genetic tools are available for studying P2RY12 in vivo?

Several genetic tools have been developed for investigating P2RY12 function in vivo:

  • P2ry12-CreER knock-in mouse line:

    • Specifically labels brain microglia and a subset of dural and choroid plexus macrophages

    • Unlike Cx3cr1-CreER, does not label pial-associated or perivascular macrophages

    • Provides robust recombination in microglia during embryonic development

    • Maintains gene expression from the endogenous locus, avoiding haploinsufficiency complications

    • Shows no recombination in the adult circulation

  • Cre-dependent reporter systems:

    • P2ry12-CreER combined with fluorescent reporters enables visualization of labeled cells

    • P2ry12-CreER with conditionally expressed Rpl22-HA allows ribosomal immunoprecipitations for transcriptional profiling

    • Comparison with other Cre lines (e.g., Cx3cr1-CreER) helps identify cell-specific gene expression patterns

  • Comparative analysis tools:

    • Differentiating genes expressed in parenchymal microglia from those in non-parenchymal macrophages

    • Identification of potential microglial-specific markers

The P2ry12-CreER line offers significant advantages for microglial studies, including specific labeling with minimal recombination in non-CNS organs and border-associated macrophages .

What experimental approaches can be used to study P2RY12 trafficking?

Several robust methodologies have been developed to investigate P2RY12 trafficking dynamics:

  • Quantitative assays for receptor internalization and recycling:

    • ELISA-based methods using N-terminal epitope-tagged receptors (e.g., HA-tagged) to quantify surface receptor expression levels before and after agonist exposure

    • Pulse-chase experiments to track receptor movement through cellular compartments

  • Microscopy techniques:

    • Immunofluorescence microscopy to visualize receptor localization

    • Co-localization studies with markers for different cellular compartments

    • Live-cell imaging with fluorescently tagged receptors to track trafficking in real-time

  • Protein-protein interaction analysis:

    • Coimmunoprecipitation to detect interactions between P2RY12 and trafficking proteins (e.g., arrestins)

    • Fluorescence-based methods to visualize protein recruitment (e.g., arrestin-GFP translocation)

  • Mutation studies:

    • Site-directed mutagenesis to identify critical residues for trafficking

    • Creation of deletion mutants to determine the role of specific domains

    • Overexpression of dominant-negative mutants of trafficking proteins to disrupt specific pathways

These techniques have been instrumental in establishing the importance of the PDZ-binding motif in P2RY12 trafficking and have revealed key mechanisms underlying receptor internalization and recycling.

How can P2RY12 activity be measured in experimental systems?

Several complementary approaches are available for measuring P2RY12 activity:

  • Signaling assays:

    • Measurement of cAMP levels to assess Gi-mediated inhibition of adenylyl cyclase

    • Monitoring of downstream effector activation (e.g., PI3K, Akt phosphorylation)

    • Calcium mobilization assays to assess coupled signaling responses

  • Platelet function tests:

    • Light-transmittance aggregometry with ADP as an agonist

    • Point-of-care assays such as VerifyNow P2Y12

    • Flow cytometry to measure platelet activation markers

  • Genetic reporter systems:

    • Transcriptional profiling using P2ry12-CreER with Rpl22-HA for ribosomal immunoprecipitation

    • Single-cell sequencing to identify cell-specific expression patterns and responses

    • Comparison of profiles obtained from different genetic tools to identify specific markers

  • Pharmacological approaches:

    • Use of specific P2RY12 antagonists (e.g., clopidogrel metabolites) to assess receptor-mediated responses

    • Dose-response studies to determine receptor sensitivity

    • Genetic variation analysis to correlate with drug response variability

This multi-modal approach to measuring P2RY12 activity provides researchers with a comprehensive toolkit for investigating receptor function in different cellular contexts and experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.