Recombinant Human P2Y purinoceptor 13 (P2RY13)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant P2RY13 is produced using heterologous systems for functional studies:

  • E. coli: Used for generating purified fragments (e.g., AA 1–49) for antibody development .

  • Lentiviral Vectors: Employed in neuronal and glial studies to modulate receptor expression in vitro and in vivo .

  • Mammalian Cell Lines (HEK293, Caco-2): Facilitate phosphorylation, trafficking, and signaling pathway analyses .

Immune and Inflammatory Regulation

  • Intestinal Inflammation: P2RY13 activation exacerbates colitis by disrupting tight junctions (ZO-1, occludin) and promoting apoptosis via IL-6/STAT3 signaling. Pharmacological inhibition with MRS2211 reduces inflammation in murine models .

  • Microglial Modulation: In P2RY13-knockout mice, microglia exhibit reduced surveillance and increased IL-1β release, suggesting a role in neuroimmune homeostasis .

Neurogenesis and CNS Function

  • P2RY13 regulates neural stem cell (NSC) activation in the subependymal zone. Lentiviral overexpression drives NSC lineage progression, while antagonists promote quiescence .

  • In astrocytes, P2RY13 activation triggers Ca²⁺ mobilization and MAPK pathways, influencing synaptic plasticity .

Bone and Metabolic Pathways

  • Knockout mice show reduced bone turnover, linking P2RY13 to osteoclast regulation .

  • Pancreatic β-cell apoptosis is mediated by P2RY13, implicating it in diabetes pathology .

Research Tools and Applications

ApplicationTools/FindingsCitation
AntibodiesMonoclonal 3E8C12 (Novus Biologicals) detects P2RY13 in WB, flow cytometry, CyTOF .
Pharmacological ProbesMRS2211 (antagonist) reduces colitis severity and neuropathic pain .
Gene EditingsiRNA knockdown in intestinal epithelial cells restores barrier function .
Disease ModelsDSS-induced colitis and LPS-treated Caco-2 monolayers replicate mucosal damage .

Clinical and Therapeutic Implications

  • Anti-inflammatory Targets: P2RY13 antagonists (e.g., MRS2211) show promise in ulcerative colitis and diabetic neuropathy .

  • Neurodegeneration: Modulating P2RY13 may enhance neurogenesis in Alzheimer’s or traumatic brain injury .

  • Thrombosis: Overlap with P2RY12 pharmacology suggests potential for dual-target inhibitors .

Challenges and Future Directions

  • Specificity Issues: Overlapping ligand affinities with P2RY12 complicate drug design .

  • Cell-Type-Specific Roles: Conditional knockout models are needed to dissect contributions of microglial vs. epithelial P2RY13 .

  • Structural Insights: Cryo-EM or X-ray crystallography of recombinant P2RY13 could refine agonist/antagonist development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format in the order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery information.
Note: All protein shipments default to standard blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
P2RY13; GPR86; GPR94; FKSG77; P2Y purinoceptor 13; P2Y13; G-protein coupled receptor 86; G-protein coupled receptor 94
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGIL LNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSS VIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTI LSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYR KSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKE TTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
Uniprot No.

Target Background

Function
P2Y purinoceptor 13 (P2RY13) is a receptor for ADP. It is coupled to G(i)-proteins and may play a role in hematopoiesis and the immune system.
Gene References Into Functions
  1. Research indicates a crosstalk between two metabotropic and one ionotropic purinergic receptor that regulates cAMP levels through adenylate cyclase 5. This interaction modulates axonal elongation triggered by neurotropic factors and the PI3K-Akt-GSK3 pathway. PMID: 22250198
  2. The p2y13 purinoceptor has been implicated in various functions. PMID: 11961076
Database Links

HGNC: 4537

OMIM: 606380

KEGG: hsa:53829

STRING: 9606.ENSP00000320376

UniGene: Hs.546396

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal

Q&A

What is the basic structure and classification of P2RY13?

P2RY13 belongs to the G protein-coupled receptor (GPCR) family and is characterized by an intracellular C terminus, seven transmembrane regions, and an extracellular N terminus. It is an approximately 41 kDa receptor composed of 354 amino acids in humans . The gene encoding P2RY13 is located on chromosome 3q25.1, and two transcript variants encoding the same protein have been identified . P2RY13 is classified as a member of the Gi-coupled P2Y receptor subfamily that responds to ADP, alongside P2RY12 and P2RY14 .

What is the distribution of P2RY13 expression in different tissues?

P2RY13 demonstrates differential expression patterns across various tissues. The receptor is strongly expressed in the spleen and adult brain, while lower expression levels are observed in the placenta, liver, lung, thymus, uterus, stomach, testis, spinal cord, small intestine, fetal brain, and adrenal gland . This varying distribution pattern suggests tissue-specific roles in different physiological processes and should be considered when designing experiments targeting specific tissue systems.

What are the key structural properties of human P2RY13?

The following table summarizes the essential structural information about human P2RY13:

Basic Information of P2RY13Details
Protein NameP2Y purinoceptor 13
Gene NameP2RY13
AliasesP2Y13, P2Y purinoceptor 13, G-protein coupled receptor 86, G-protein coupled receptor 94
OrganismHomo sapiens (Human)
UniProt IDQ9BPV8
Transmembrane Domains7
Length (amino acids)354
Chromosomal Location3q25.1

The receptor sequence and structural characteristics are fundamental for designing recombinant expression systems and developing experimental protocols for functional studies .

What are the primary signaling pathways activated by P2RY13?

P2RY13 primarily signals through the inhibition of adenylyl cyclase via Gi proteins. Upon activation by ADP or ADP-like agonists, P2RY13 triggers several intracellular signaling events, including Ca²⁺/IP₃ release, cAMP inhibition, and [³⁵S]GTPγS binding . When designing experiments to investigate P2RY13 function, researchers should incorporate appropriate assays to measure these specific signaling events. For example, measuring changes in intracellular cAMP levels using ELISA or FRET-based assays provides a reliable readout of P2RY13 activation, while calcium imaging can detect immediate receptor responses.

How does P2RY13 differ functionally from other P2Y receptors?

P2RY13 is one of eight known nucleotide P2Y receptors in mammals (P2RY1, P2RY2, P2RY4, P2RY6, P2RY11-14), each with distinct pharmacological selectivity . Unlike P2RY1, which couples to Gq proteins and primarily increases intracellular calcium, P2RY13 couples to Gi proteins to inhibit adenylyl cyclase . P2RY13 demonstrates higher selectivity for ADP over ATP compared to some other P2Y receptors, with ADP-like agonists exhibiting approximately three orders of magnitude higher potency than ATP-like agonists . When studying P2RY13 in systems that express multiple P2Y receptors, selective antagonists and careful interpretation of signaling readouts are essential to distinguish P2RY13-specific effects.

What physiological processes involve P2RY13 signaling?

P2RY13 has been implicated in multiple physiological processes including cell proliferation, survival, high-density lipoprotein endocytosis, neuromuscular transmission, neuroprotection, and neuronal differentiation . Additionally, studies in mice have shown that P2RY13 plays a role in bone remodeling, with knockout of the receptor resulting in reduced bone turnover . The receptor is also involved in neurotransmission, metabolism, pain perception, and immune function . When investigating P2RY13 in specific physiological contexts, researchers should design experiments that account for tissue-specific differences in receptor expression and function.

What are the optimal expression systems for producing recombinant P2RY13?

For recombinant expression of human P2RY13, mammalian expression systems such as HEK293 or CHO cells are typically preferred over bacterial or insect cell systems due to the need for proper post-translational modifications and membrane insertion of this complex transmembrane protein. When establishing a stable expression system, consider using inducible promoters to control expression levels, as GPCR overexpression can lead to constitutive activity or receptor internalization . After transfection, validation of successful expression should include Western blot analysis using specific antibodies against P2RY13 or attached epitope tags, as well as functional assays demonstrating proper signaling responses to ADP.

How can researchers accurately measure P2RY13 activation in experimental settings?

Several complementary approaches can be used to measure P2RY13 activation:

  • cAMP inhibition assays: Since P2RY13 is Gi-coupled, measuring decreases in forskolin-stimulated cAMP production provides a direct assessment of receptor activation.

  • [³⁵S]GTPγS binding assays: This method directly measures G-protein activation following receptor stimulation.

  • Calcium mobilization assays: Although not directly coupled to calcium signaling, P2RY13 activation can indirectly affect calcium levels through βγ subunit-mediated effects.

  • Receptor internalization assays: Using fluorescently tagged receptors to track agonist-induced internalization.

Researchers should be aware that EC₅₀ values for P2RY13 activation vary significantly between heterologous expression systems (EC₅₀ of ADP-like agonists: 17.2 nM) and endogenous expression systems (EC₅₀: 1.76 μM) . This discrepancy highlights the importance of characterizing P2RY13 responses in physiologically relevant contexts.

What are the most selective agonists for studying P2RY13 function?

The following table summarizes the potency of various agonists for P2RY13 based on meta-analysis data:

Agonist TypeEC₅₀ for Heterologously Expressed P2RY13EC₅₀ for Endogenously Expressed P2RY13
ADP-like agonists (general)17.2 nM (95% CI: 7.7–38.5)1.76 μM (95% CI: 0.3–10.06)
2MeSADPLower than ADP (particularly for human P2RY13)Similar to ADP for functional responses
ATP-like agonists0.45 μM (95% CI: 0.06–3.15)Not clearly established

How do tissue-specific factors influence P2RY13 pharmacology and function?

Meta-analysis data suggests significant differences in P2RY13 pharmacology across different tissues. For instance, in blood-derived cells, the EC₅₀ value for ADP-like agonists at P2RY13 was 17.9 μM (95% CI: 0.8–426), whereas in brain tissue, the EC₅₀ value was 0.3 μM (95% CI: 0.02–4.89) . These differences may reflect tissue-specific expression of regulatory proteins, variations in membrane composition, or differential expression of receptor interactors.

When investigating P2RY13 in specific tissues, researchers should calibrate their experimental systems using tissue-specific positive controls and consider complementary approaches such as tissue-specific knockout models or siRNA-mediated knockdown to confirm receptor involvement in observed responses. Additionally, the possibility of heterodimerization with other receptors should be considered when interpreting tissue-specific pharmacological profiles.

What are the species-specific differences in P2RY13 pharmacology?

Significant species-specific differences exist in P2RY13 pharmacology. Human P2RY13 demonstrates higher potency in response to ADP-like agonists (EC₅₀: 7.4 nM, 95% CI: 2.9–18.8) compared to rodent P2RY13 (EC₅₀: 149.8 nM, 95% CI: 64.3–348.8) . In rodents, the EC₅₀ for P2RY13-mediated functional responses was lower for 2MeSADP compared to ADP and ADPβS .

These species differences have important implications for translational research. When using animal models to study P2RY13-related processes, researchers should be aware that pharmacological findings might not directly translate to human systems. Comparative studies including both human and rodent receptors are recommended to establish appropriate dosing regimens and interpret preclinical findings accurately.

How do immediate signaling events correlate with long-term functional outcomes for P2RY13?

A significant discrepancy exists between the concentrations of agonists required to elicit immediate signaling events (e.g., calcium signaling, cAMP inhibition) versus those needed for longer-term functional outcomes (e.g., protein phosphorylation, cell proliferation) . This could be due to several factors:

  • Receptor desensitization or internalization following prolonged exposure to agonists

  • Differences in receptor expression levels between heterologous and endogenous systems

  • Requirements for sustained signaling to achieve functional outcomes

  • Potential cooperation with other receptors in physiological contexts

To address this discrepancy, researchers should design time-course experiments that correlate immediate signaling events with downstream functional outcomes. Additionally, strategies to prevent receptor desensitization (e.g., using partial agonists or pulsatile stimulation) may help bridge the gap between short-term signaling and long-term functional studies .

What novel approaches can improve the specificity of P2RY13 targeting in research?

Current challenges in P2RY13 research include the lack of highly selective agonists and the difficulty in distinguishing P2RY13-mediated responses from those of other ADP-responsive receptors like P2RY1 and P2RY12. Innovative approaches to address these challenges include:

  • Development of biased agonists that selectively activate specific downstream pathways

  • Creation of conditional knockout models for tissue-specific P2RY13 deletion

  • Implementation of CRISPR-Cas9 genome editing to introduce tagged versions of the endogenous receptor

  • Application of optogenetic or chemogenetic tools for temporally precise receptor activation

  • Development of proximity labeling approaches to identify tissue-specific P2RY13 interactors

When implementing these approaches, researchers should carefully validate their models using complementary pharmacological tools and functional readouts specific to P2RY13 signaling.

How can inconsistencies in P2RY13 pharmacology data be reconciled?

Meta-analysis of P2RY13 studies reveals inconsistencies in reported EC₅₀ values across different experimental systems . These inconsistencies may arise from differences in receptor expression levels, experimental conditions, or readout methods. To reconcile these inconsistencies, researchers should:

  • Standardize expression systems and experimental conditions when possible

  • Directly compare different readout methods within the same experimental setup

  • Quantify receptor expression levels using techniques like radioligand binding or quantitative immunoblotting

  • Consider the impact of receptor reserve on apparent potency measurements

  • Account for potential receptor heterodimerization or cross-talk with other signaling pathways

Comprehensive characterization of recombinant P2RY13 in well-defined systems, followed by systematic comparison with endogenous receptor responses, will help establish more reliable pharmacological parameters for this receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.