Recombinant Human P2Y purinoceptor 14 (P2RY14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human P2Y Purinoceptor 14 (P2RY14)

Recombinant Human P2Y purinoceptor 14 (P2RY14) is a synthetic protein engineered to mimic the human P2Y14 receptor, a G-protein-coupled receptor (GPCR) activated by UDP-sugars such as UDP-glucose, UDP-galactose, and UDP-N-acetylglucosamine . This recombinant protein is produced via heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) and serves as a critical tool for studying receptor structure, function, and therapeutic applications .

Production and Characterization

Recombinant P2RY14 is produced with high purity (>85–95%) and characterized using techniques like SDS-PAGE and Western blotting . Key parameters include:

ParameterDetails
Purity>95% (SDS-PAGE)
Host SystemsE. coli (prokaryotic), mammalian (e.g., HEK293)
Molecular Weight~36 kDa (theoretical)
BufferPBS (pH 7.4) with stabilizers (e.g., 5% trehalose)
Endotoxin Level<1.0 EU/μg (E. coli variants)

Role in Immune and Inflammatory Responses

P2RY14 modulates eosinophil recruitment in asthma models. In P2ry14 knockout mice, airway eosinophilia and hyperresponsiveness were reduced compared to wild-type mice . Recombinant P2RY14 is used to study:

  • Eosinophil chemokinesis via UDP-glucose-mediated signaling .

  • Positive feedback loops where eosinophils release UDP-glucose, amplifying inflammation .

Hematopoietic Stress Response

P2RY14 protects hematopoietic stem/progenitor cells (HSPCs) from stress-induced senescence. In irradiated mice, P2ry14 deficiency led to increased ROS, p16INK4a expression, and reduced regenerative capacity .

Therapeutic and Diagnostic Potential

Recombinant P2RY14 is used to develop antagonists for inflammatory diseases. For example, small-molecule antagonists (e.g., PPTN) reduce eosinophilia in asthma models by blocking P2RY14-mediated signaling . Additionally, its role in insulin secretion and kidney inflammation highlights potential therapeutic targets .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of that specified tag.
Synonyms
P2RY14; GPR105; KIAA0001; P2Y purinoceptor 14; P2Y14; G-protein coupled receptor 105; UDP-glucose receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Uniprot No.

Target Background

Function
P2Y14 receptor is a receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. It is not activated by ATP, ADP, UTP, or ATP.
Gene References Into Functions
  1. P2Y14R is downregulated in hCPCs derived from heart failure patients. Augmenting P2Y14R expression levels in aged/diseased hCPCs antagonizes senescence and improves functional responses. PMID: 28980705
  2. This study suggests that P2Y14 expression could serve as a phenotypic marker to further dissect placental HSPCs. PMID: 28804125
  3. Data show that thymidine 5'-O-monophosphorothioate (TMPS) diminished UDPG-evoked intracellular calcium mobilization in a stable HEK293T cell line overexpressing the P2Y14 receptor. PMID: 27732965
  4. UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2. PMID: 24847057
  5. PPTN acts as a highly selective high-affinity antagonist of the P2Y14-R. PMID: 23592514
  6. These findings support the notion that UDP-glucose is a stable and potent proinflammatory mediator that promotes P2Y(14)-R-mediated neutrophil motility via Rho/Rho kinase activation. PMID: 22673622
  7. The IUPHAR Subcommittee for P2Y receptor nomenclature and classification reviews the current knowledge of the UDP-glucose receptor and presents reasons for including it in the P2Y receptor family as the P2Y(14) receptor. PMID: 12559763
  8. This receptor identifies a quiescent, primitive population of hematopoietic cells restricted to bone marrow and mediates primitive cell responses to specific hematopoietic microenvironments. PMID: 12842911
  9. Discrete expression of GPR105 within the immature subset of monocyte-derived dendritic cells (DC) suggests a possible role for this receptor in DC activation. PMID: 12902497
  10. We have demonstrated the presence of P2Y(14) receptor protein in platelets, but no contribution of this receptor to several measures of platelet function has been observed. PMID: 18690346
  11. UDP-glucose stimulated IL-8 production via P2RY14 in human endometrial epithelial cells but not stromal cells. PMID: 19454705

Show More

Hide All

Database Links

HGNC: 16442

OMIM: 610116

KEGG: hsa:9934

STRING: 9606.ENSP00000308361

UniGene: Hs.2465

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.

Q&A

What is P2Y purinoceptor 14 and how does it differ from other purinergic receptors?

P2Y purinoceptor 14 (P2RY14) belongs to the P2Y purinoceptor subfamily, a group of eight molecularly defined G-protein coupled receptors that respond to nucleotides and nucleotide sugars. Unlike other P2Y receptors that primarily respond to adenine nucleotides, P2RY14 is distinctively activated by UDP and UDP-sugars, including UDP-glucose, UDP-galactose, UDP-glucuronic acid, and UDP-N-acetylglucosamine. P2RY14 belongs to the P2Y12-receptor subfamily and signals through Gi protein, inhibiting adenylyl cyclase activity and decreasing intracellular cAMP levels .

What are the principal natural ligands of P2RY14 and their relative potencies?

P2RY14 is potently activated by UDP and a class of carbohydrates known as UDP-sugars. Historically considered primarily a nucleotide sugar-activated receptor, recent discoveries indicate that UDP is approximately 5-fold more potent than UDP-sugars at the P2RY14 receptor, suggesting it may be the most important agonist under certain physiological conditions . Among UDP-sugars, UDP-glucose, UDP-galactose, and UDP-glucuronic acid exhibit similar potencies, while UDP-N-acetylglucosamine is approximately 10-fold less potent . These ligands activate the receptor with EC50 values in the nanomolar range, with UDP-glucose demonstrating an EC50 of approximately 82-107 nM in heterologous expression systems .

Where is P2RY14 primarily expressed in humans?

P2RY14 is relatively broadly expressed in human tissues. It is prominently associated with immune and inflammatory cells as well as with many epithelia . Significant expression has been documented in hematopoietic stem/progenitor cells, where it plays a role in homeostasis . In the nervous system, P2RY14 is expressed in Schwann cell precursors (SCPs) and Schwann cells (SCs), including satellite glial cells . This widespread distribution underscores its potential involvement in diverse physiological processes including inflammation, immune response, and glial cell function.

What is the primary signaling pathway activated by P2RY14?

P2RY14 primarily signals through the inhibitory G-protein (Gi) pathway. Upon activation, P2RY14 couples to Gi-family G-proteins, leading to inhibition of adenylyl cyclase and subsequent decrease in intracellular cAMP levels . This signaling mechanism has been confirmed in multiple cell types, including HEK293 cells and C6 rat glioma cells stably expressing P2RY14. The involvement of Gi is further validated by the complete abolishment of P2RY14-mediated responses following pertussis toxin treatment, which ADP-ribosylates and inactivates Gi proteins .

What secondary signaling pathways can be activated downstream of P2RY14?

Beyond cAMP inhibition, P2RY14 activation can trigger additional signaling cascades. In RBL-2H3 mast cells expressing P2RY14, UDP-glucose promotes calcium mobilization in a pertussis toxin-sensitive manner, indicating Gi-dependent calcium signaling . Additionally, P2RY14 activation leads to phosphorylation of ERK1/2, demonstrating coupling to MAP kinase signaling pathways . In functional contexts, P2RY14 stimulation in RBL-2H3 cells results in β-hexosaminidase release, suggesting a role in degranulation responses. These diverse signaling outputs highlight the multifaceted nature of P2RY14 signal transduction beyond simple cAMP inhibition.

How does the KDKE motif contribute to ligand recognition by P2RY14?

Between transmembrane helices 2 and 7 of P2RY14, researchers have identified a conserved salt bridging chain (K2.60-D2.64-K7.35-E7.36, referred to as the KDKE motif) that plays a crucial role in ligand discrimination . This structural element helps the receptor distinguish between different UDP-sugars, including UDP-glucose, UDP-galactose, UDP-glucuronic acid, and UDP-N-acetylglucosamine . Molecular dynamics simulations coupled with functional studies have revealed that UDP-glucose might activate the receptor by bridging transmembrane helices 2 and 7, with the KDKE chain serving as a critical recognition element. Interestingly, this KDKE chain has been identified as a conserved functional motif for sugar binding in both P2RY14 and P2Y purinoceptor 12 (P2Y12) .

What expression systems are most suitable for recombinant P2RY14 studies?

Several expression systems have proven effective for studying recombinant P2RY14. HEK293 cells stably expressing P2RY14 using retrovirus expression systems have successfully demonstrated robust receptor function, with UDP-glucose promoting concentration-dependent inhibition of forskolin-stimulated cAMP accumulation . C6 rat glioma cells have also served as an excellent background for P2RY14 expression, offering robust inhibitory effects on cAMP levels in response to UDP-glucose with EC50 values around 107 nM . When selecting an expression system, researchers should consider the endogenous expression of other purinergic receptors that might complicate data interpretation. Cell lines that naturally express P2RY14, such as RBL-2H3 mast cells, can also be valuable for studying physiologically relevant signaling in a native context .

What functional assays are most appropriate for measuring P2RY14 activity?

Multiple assay platforms can effectively measure P2RY14 activity:

  • cAMP assays: Measuring inhibition of forskolin-stimulated cAMP accumulation provides a direct readout of receptor activity through its primary Gi-coupled pathway. This approach has been successfully employed in both intact cells and membrane preparations .

  • Calcium mobilization assays: Although not the primary pathway, P2RY14 activation can lead to calcium responses in certain cell types, providing an alternative readout system. In RBL-2H3 mast cells, UDP-glucose promotes concentration-dependent calcium mobilization that is blocked by pertussis toxin .

  • ERK1/2 phosphorylation: Measuring activation of MAP kinase pathways through phosphorylation of ERK1/2 can provide insights into downstream signaling events triggered by P2RY14 activation .

  • Functional cellular responses: Cell-type specific assays such as β-hexosaminidase release from RBL-2H3 cells or assessment of Schwann cell precursor self-renewal can provide physiologically relevant measures of receptor function .

What pharmacological tools are available for studying P2RY14?

Several important pharmacological tools exist for P2RY14 research:

  • Agonists: Natural agonists include UDP and UDP-sugars (UDP-glucose, UDP-galactose, UDP-glucuronic acid, and UDP-N-acetylglucosamine) . Additionally, synthetic agonists like MRS2690 offer selective activation of P2RY14 .

  • Antagonists: PPTN (4-[4-(4-piperidinyl)phenyl]-7-[4-(trifluoromethyl)phenyl]-2-naphthalenecarboxylic acid hydrochloride) is a highly selective P2RY14 inhibitor useful for blocking receptor function .

  • Signaling pathway modulators: Pertussis toxin serves as an important tool to confirm Gi-dependent signaling by inactivating Gi proteins through ADP-ribosylation .

When designing experiments, researchers should consider that UDP-sugars are subject to breakdown by ecto-nucleotide pyrophosphatases but are not good substrates for ecto-nucleotidases that inactivate extracellular nucleotide agonists. This distinct metabolic profile means that the kinetics of UDP-glucose metabolism differ markedly from those of ATP, potentially affecting experimental outcomes .

How can researchers distinguish between P2RY14 and other P2Y receptor signaling in systems with multiple purinergic receptors?

Distinguishing P2RY14 activity from other P2Y receptors requires a multifaceted approach:

What is known about the structural basis of agonist binding to P2RY14?

Molecular modeling and functional studies have provided insights into P2RY14 agonist binding:

UDP-glucose binds to an extracellular pocket involving transmembrane (TM) helices 2 and 7, serving as an intramolecular "glue" attaching to TM6 and TM7 to activate the receptor . The UDP-glucose-induced conformational changes primarily affect TM6 and TM7, similar to agonist-induced changes observed in the related P2Y12 receptor . Between TM2 and TM7, the conserved KDKE salt bridging chain (K2.60-D2.64-K7.35-E7.36) plays a crucial role in distinguishing different UDP-sugars . Molecular dynamics simulations integrated with functional studies have identified the precise uridine diphosphate (UDP)-sugar-binding site on P2RY14 and revealed the molecular interactions responsible for receptor activation .

What role does P2RY14 play in Schwann cell biology and neuropathology?

P2RY14 serves as a critical regulator of Schwann cell precursor (SCP) self-renewal, Schwann cell (SC) proliferation, and neurofibroma initiation . In SCPs, P2RY14 signaling through Gi inhibits adenylate cyclase, decreasing cAMP levels and promoting self-renewal. Knockout of P2RY14 in mouse models decreased SC proliferation, improved nerve Remak bundle morphology, and decreased tumor initiation in neurofibroma models . P2RY14 inhibition with PPTN decreases mouse SCP self-renewal through modulation of cAMP, suggesting pharmacological targeting of this receptor could have therapeutic implications for neurofibroma and potentially other Schwann cell-related pathologies .

What are common pitfalls in P2RY14 experimental design and how can they be addressed?

When studying P2RY14, researchers should be aware of several potential experimental challenges:

  • Overlapping receptor expression: Many cell types express multiple P2Y receptors that respond to similar ligands. Always include appropriate controls such as selective antagonists or genetic knockdown approaches to confirm P2RY14-specific effects.

  • Nucleotide contamination: Commercial UDP-sugar preparations may contain UDP contamination, which is more potent at P2RY14. High-quality, purified ligands are essential for accurate potency determinations .

  • Ectoenzyme activity: Cell surface enzymes can metabolize nucleotides and nucleotide sugars, affecting ligand availability. Consider the differential metabolism of UDP versus UDP-sugars when interpreting kinetic response data .

  • Pertussis toxin controls: Always include pertussis toxin controls to verify the Gi-dependence of observed responses and distinguish them from parallel signaling pathways .

  • Receptor reserve considerations: In recombinant systems with high expression levels, apparent potencies may be influenced by receptor reserve. Consider this possibility when comparing results across different expression systems or with native receptor expression.

How can P2RY14 knockout or knockdown models be effectively utilized?

P2RY14 knockout or knockdown models provide powerful tools for understanding receptor function:

  • P2RY14-knockout mice are now available and have been used to demonstrate the receptor's role in vivo, showing increased survival, decreased SC proliferation, improved nerve Remak bundle morphology, and decreased tumor initiation in neurofibroma models .

  • siRNA approaches targeting P2RY14 have been successfully employed in cell lines and in mouse uterus, providing a flexible approach for tissue-specific receptor knockdown .

  • When using knockout or knockdown approaches, researchers should consider potential compensatory mechanisms that might emerge in chronic absence of receptor expression. Acute pharmacological inhibition with selective antagonists like PPTN can complement genetic approaches by revealing immediate receptor functions without triggering compensatory adaptations .

  • In heterologous expression systems, empty vector controls are essential for distinguishing receptor-specific from non-specific effects, as demonstrated in studies using HEK293 and C6 glioma cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.