Recombinant Human P2Y purinoceptor 8 (P2RY8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
P2RY8; P2Y purinoceptor 8; P2Y8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVI FMINLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVE RFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLK WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAA VVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF QLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
Uniprot No.

Target Background

Function
P2RY8 acts as a probable receptor for purines coupled to G-proteins.
Gene References Into Functions
  1. The fusion of P2RY8 and CRLF2 has been linked to childhood B-cell acute lymphoblastic leukemia. PMID: 27637012
  2. P2RY8 promotes the clustering of activated B cells within follicles in a follicular dendritic cell (FDC)-dependent manner. PMID: 26573295
  3. P2RY8-CRLF2-positive clones lack the necessary proliferative or selective advantage to evolve into a disease-relevant relapse clone. PMID: 23091296
  4. Patients with intermediate risk B-cell precursor acute lymphoblastic leukemia exhibit a poor prognosis when P2RY8-CRLF2 fusion is present, but not when CRLF2 is overexpressed. PMID: 22484421
  5. Research indicates an extremely high relapse rate (71% +/- 19%) in non-high-risk precursor B-cell acute lymphoblastic leukemia patients with P2RY8-CRLF2 rearrangement. PMID: 20378752
  6. P2RY8 is expressed in leukemic cells and plays an unexpected role in the pathogenesis of acute leukemia. PMID: 17487742
  7. SOX5 is upregulated through promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma. PMID: 17554380

Show More

Hide All

Database Links

HGNC: 15524

OMIM: 300525

KEGG: hsa:286530

STRING: 9606.ENSP00000370697

UniGene: Hs.111377

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Barely detectable in normal blood leukocytes. Weaker expression was seen in heart, kidney and lung. Not detected in brain.

Q&A

What is P2Y Purinoceptor 8 (P2RY8) and what is its basic function?

P2Y Purinoceptor 8 (P2RY8) is a G-protein coupled receptor that belongs to the P2Y receptor family. It has established roles in germinal center (GC) B cell migration inhibition and growth regulation . The receptor functions primarily through GPCR-RhoA signaling pathways and influences downstream effectors including AKT and ERK activity . P2RY8 appears to restrain signals that lead to plasma cell formation and accumulation, which suggests its critical role in maintaining B cell homeostasis .

In its normal functioning state, P2RY8 contributes to immune tolerance by:

  • Inhibiting B cell migration

  • Regulating cytoskeletal reorganization through F-actin abundance

  • Restraining plasma cell development

  • Reinforcing negative selection of self-reactive B cells

Research indicates that P2RY8 is particularly active in immature B cells, making it potentially important for early B cell development checkpoints .

What expression systems are commonly used for recombinant P2RY8 production?

Based on available research data, recombinant P2RY8 can be produced using several expression systems, each with specific advantages for different experimental applications :

Expression SystemApplicationsPurityProtein Variants
Cell-Free ExpressionStructural studies, protein-protein interactions≥85% by SDS-PAGEFull-length Human P2RY8, Chicken P2RY8
E. coliHigh yield protein production, functional studies≥85% by SDS-PAGEPartial Human P2RY8, Partial Chicken P2RY8
YeastPost-translational modifications≥85% by SDS-PAGEPartial Human P2RY8, Partial Chicken P2RY8
BaculovirusComplex proteins, membrane proteins≥85% by SDS-PAGEPartial Human P2RY8, Partial Chicken P2RY8
Mammalian CellNative conformation, proper folding≥85% by SDS-PAGEPartial Human P2RY8, Partial Chicken P2RY8

For researchers focused on functional studies of P2RY8, the choice of expression system should be determined by the specific experimental requirements, particularly regarding post-translational modifications and proper protein folding needed for receptor functionality .

How can researchers validate P2RY8 expression in experimental models?

For effective validation of P2RY8 expression in research models, multiple complementary approaches should be employed:

  • Antibody-based detection methods:

    • Western blotting using specific P2RY8 antibodies (such as rabbit polyclonal antibodies against human P2RY8)

    • Flow cytometry for detection in cellular models

    • Immunohistochemistry for tissue localization studies

  • Genetic validation:

    • RT-PCR to confirm mRNA expression, similar to methods used to detect other P2Y receptors

    • qPCR for quantitative measurement of expression levels

    • RNA sequencing for comprehensive transcriptional analysis

  • Functional validation:

    • SRF-luciferase assays to measure downstream signaling activity

    • Calcium mobilization assays to assess receptor functionality

    • Protein degradation assays using cycloheximide (CHX) to measure protein stability

When implementing these validation methods, researchers should include appropriate positive and negative controls and consider the dynamic regulation of P2RY8 expression in response to various stimuli, as demonstrated in PBMC stimulation assays .

How should researchers design experiments to study P2RY8 signaling pathways?

Designing robust experiments to investigate P2RY8 signaling requires multiple complementary approaches that address both upstream regulation and downstream effectors:

  • Receptor activation studies:

    • Utilize GGG (putative ligand) stimulation to activate P2RY8 signaling

    • Compare wild-type receptor responses to those of variant forms (e.g., L257F, N97K, E323G)

    • Monitor immediate signaling events using calcium mobilization assays, similar to methods described for other P2Y receptors

  • GPCR-RhoA signaling assessment:

    • Implement SRF-luciferase assays to quantify RhoA pathway activation

    • Analyze F-actin abundance as a downstream readout of RhoA activity

    • Compare signaling outputs between wild-type and variant P2RY8 forms

  • PI3K/AKT and ERK pathway analysis:

    • Perform phospho-specific western blotting to detect activated (phosphorylated) AKT and ERK

    • Use pathway-specific inhibitors to delineate signaling hierarchies

    • Correlate signaling activity with functional outcomes (migration, differentiation)

  • Temporal signaling dynamics:

    • Conduct time-course experiments to characterize acute versus chronic signaling responses

    • Implement protein degradation assays using cycloheximide (CHX) to assess receptor turnover rates

    • Monitor negative feedback loops that may modulate receptor signaling

Data analysis should incorporate pathway modeling approaches to integrate multiple signaling readouts and identify key regulatory nodes specific to P2RY8 function.

What are the methodological approaches to study P2RY8 variants in autoimmune disease models?

To effectively investigate the role of P2RY8 variants in autoimmune disease pathogenesis, researchers should implement a multi-level experimental approach:

  • Genetic characterization:

    • Perform targeted sequencing of P2RY8 in autoimmune disease cohorts

    • Validate variants using Sanger sequencing as described in previous studies

    • Analyze variant frequency in healthy and disease populations

    • Assess variant impact using in silico prediction tools (PolyPhen, SIFT, CADD)

  • Functional validation of variants:

    • Generate expression vectors containing wild-type and mutant P2RY8 using site-directed mutagenesis

    • Conduct parallel functional assays comparing wild-type versus variant receptor activity:

      • Protein stability and degradation assays

      • Migration assays to assess cytoskeletal reorganization

      • Signaling assays (SRF-luciferase, AKT/ERK phosphorylation)

  • In vivo modeling:

    • Develop bone marrow chimeric mice expressing wild-type or variant P2RY8

    • Utilize V₈3H9 transgenic models to assess impact on self-reactive B cell selection

    • Analyze B cell development and tolerance checkpoints through flow cytometry

    • Challenge with relevant autoimmune disease triggers to assess pathology

  • Patient sample analysis:

    • Correlate P2RY8 expression levels with disease manifestations (e.g., lupus nephritis)

    • Examine age-associated B cells and plasma cell frequencies

    • Perform ex vivo functional assays using patient cells

This integrated approach enables researchers to establish causality between P2RY8 variants and autoimmune disease manifestations while revealing the underlying molecular mechanisms.

How can researchers effectively measure P2RY8-mediated regulation of B cell migration and plasma cell development?

To comprehensively evaluate P2RY8's regulatory roles in B cell migration and plasma cell development, researchers should implement these methodological approaches:

  • B cell migration assessment:

    • Transwell migration assays with chemokine gradients (e.g., CXCL12)

    • Real-time cell migration tracking using live-cell imaging

    • Competitive homing assays in vivo comparing cells with different P2RY8 expression levels

    • Migration assays in the presence and absence of P2RY8 ligands (e.g., GGG)

  • Plasma cell differentiation experiments:

    • LPS-stimulated B cell cultures with retroviral transduction of wild-type or mutant P2RY8

    • Flow cytometric quantification of plasma cell markers

    • Assessment of immunoglobulin secretion by ELISA

    • Evaluation of plasma cell transcription factors (e.g., BLIMP1, XBP1)

  • In vivo plasma cell development:

    • Generate bone marrow chimeric mice with partial P2RY8 expression in B cells

    • Immunize with T-dependent antigens to induce germinal center responses

    • Analyze plasma cell frequencies in spleen and bone marrow compartments

    • Assess correlation between P2RY8 expression and plasma cell formation

  • Mechanistic dissection:

    • Analyze AKT and ERK signaling as mediators of plasma cell differentiation

    • Investigate autocrine/paracrine GGG production using appropriate assays

    • Determine the impact of P2RY8 on key transcriptional regulators of plasma cell development

This multi-faceted approach enables researchers to establish direct links between P2RY8 function and specific B cell developmental processes relevant to immunity and autoimmune pathology.

What are the common technical challenges in working with recombinant P2RY8 protein?

Researchers working with recombinant P2RY8 face several technical challenges that require specific troubleshooting approaches:

  • Protein expression and folding issues:

    • As a seven-transmembrane G-protein coupled receptor, P2RY8 presents folding challenges in recombinant systems

    • Different expression systems produce varying results in terms of protein folding and functionality

    • Solution: Comparative assessment of expression in cell-free, bacterial, yeast, insect, and mammalian systems to identify optimal conditions for specific experimental needs

  • Protein stability and degradation:

    • P2RY8 variants show differential stability in experimental systems

    • Wild-type and variant proteins may degrade at different rates, complicating comparative analyses

    • Solution: Implement protein degradation assays using cycloheximide (CHX) to quantify and account for differential protein stability

  • Functional validation challenges:

    • Confirming proper folding and functionality of recombinant P2RY8

    • Ensuring physiologically relevant signaling responses

    • Solution: Utilize functional readouts such as SRF-luciferase assays, calcium mobilization, and downstream signaling analysis (AKT/ERK phosphorylation)

  • Antibody specificity issues:

    • Cross-reactivity with other P2Y family members

    • Inadequate detection of specific variants or conformational states

    • Solution: Validate antibodies using multiple approaches, including P2RY8-deficient cells as negative controls

  • Ligand availability and specificity:

    • Limited commercial availability of specific P2RY8 ligands

    • Potential cross-reactivity with other purinergic receptors

    • Solution: Careful titration of ligands and inclusion of receptor-specific controls

Addressing these challenges requires methodical optimization and validation approaches to ensure reproducible and physiologically relevant experimental results.

How can researchers optimize P2RY8 expression analysis in patient samples?

Optimizing P2RY8 expression analysis in patient samples requires addressing several methodological considerations:

  • Sample collection and processing:

    • Standardize blood collection methods to minimize ex vivo activation

    • Process samples within a consistent timeframe to prevent degradation

    • Cryopreserve PBMCs using standardized protocols for batch analysis

    • Validate that freezing/thawing doesn't alter P2RY8 detection

  • Flow cytometry optimization:

    • Select antibodies with validated specificity for P2RY8

    • Optimize staining protocols (concentration, incubation time, temperature)

    • Include appropriate isotype controls and fluorescence-minus-one (FMO) controls

    • Design multi-parameter panels to simultaneously assess P2RY8 and relevant B cell subsets

  • Stimulation conditions:

    • Standardize stimulation protocols for ex vivo functional assays

    • Consider testing multiple stimuli based on previous research:

      • Cytokines: IL-6, IL-2, IL-21, IFN-α2, IFN-β, IFN-γ, IL-10

      • TLR ligands: LPS, R837, CPG-A

      • B cell receptor stimulation: αIgA, G, M

      • P2RY8 ligands: GGG

  • Normalization and comparative analysis:

    • Establish consistent gating strategies across samples

    • Normalize expression to appropriate reference populations

    • Use consistent metrics for quantification (MFI, percent positive)

    • Include healthy controls matched for age, sex, and ethnicity

  • Integration with clinical data:

    • Correlate P2RY8 expression with disease manifestations (e.g., lupus nephritis)

    • Consider disease activity indices in analysis

    • Account for treatment effects on receptor expression

By addressing these methodological considerations, researchers can generate more reproducible and clinically relevant data on P2RY8 expression in patient populations.

What controls should be included in P2RY8 functional studies?

Rigorous P2RY8 functional studies require comprehensive controls to ensure data validity and interpretability:

  • Genetic controls:

    • Wild-type P2RY8 expression constructs alongside variant forms

    • Empty vector controls for transfection/transduction experiments

    • CRISPR knockout controls to establish baseline in relevant cell types

    • Dose-matched expression controls when comparing variants

  • Pharmacological controls:

    • Specific receptor antagonists (when available)

    • Pathway inhibitors targeting downstream effectors:

      • RhoA pathway inhibitors

      • PI3K/AKT inhibitors

      • ERK pathway inhibitors

    • Vehicle controls for all treatments

  • Biological controls:

    • Positive controls from other purinergic receptors with established functions

    • Cell type-specific controls (e.g., P2RY8-high vs. P2RY8-low B cell subsets)

    • Species-specific controls when working across model systems

    • Tissue/compartment-matched controls (e.g., comparing bone marrow vs. splenic B cells)

  • Technical controls:

    • In migration assays: random migration vs. chemokine-directed migration

    • In signaling assays: time-matched unstimulated controls

    • In degradation assays: protein synthesis inhibitor-only controls

    • In transduction experiments: fluorescent protein expression matching

  • Stimulation/activation controls:

    • Dose-response curves for ligands and stimuli

    • Time-course controls to capture signaling dynamics

    • Positive control stimuli known to affect similar pathways

    • Cross-desensitization controls when testing multiple receptors

Implementation of these comprehensive controls ensures that experimental observations can be specifically attributed to P2RY8 function rather than confounding factors.

How should researchers interpret discrepancies between in vitro and in vivo P2RY8 functional studies?

Addressing discrepancies between in vitro and in vivo P2RY8 studies requires systematic analysis of multiple factors:

  • Context-dependent signaling considerations:

    • In vitro systems may lack the full complement of signaling components present in vivo

    • The microenvironment affects receptor function through:

      • Ligand availability and concentration gradients

      • Presence of competing receptors and signaling pathways

      • Cell-cell interactions that modulate receptor function

    • Analytical approach: Map the signaling network context in both systems and identify missing components

  • Temporal dynamics differences:

    • In vitro acute responses vs. in vivo chronic adaptation

    • Receptor desensitization and internalization kinetics

    • Compensatory mechanisms that operate over different timescales

    • Analytical approach: Conduct parallel time-course experiments at matching intervals

  • Cell population heterogeneity:

    • In vitro homogeneous cultures vs. in vivo heterogeneous populations

    • Differential expression of P2RY8 across B cell developmental stages

    • Varied receptor function based on cellular activation state

    • Analytical approach: Single-cell analysis techniques to resolve population heterogeneity

  • Case study interpretation framework:

    • Example: P2RY8 variants showed variable effects on plasma cell differentiation in vitro, with L257F showing the strongest effect, while other variants had minimal impact

    • Yet in vivo chimeric mouse studies showed consistent effects on plasma cell formation

    • Analytical approach: Determine if threshold effects, compensatory mechanisms, or microenvironmental factors explain the discrepancy

  • Reconciliation strategies:

    • Develop more physiologically relevant in vitro systems (3D cultures, co-cultures)

    • Implement ex vivo analysis of cells from in vivo models

    • Use systems biology approaches to model context-dependent signaling networks

    • Validate key findings across multiple experimental systems

This structured approach to discrepancy analysis enables more accurate interpretation of P2RY8 function across experimental systems.

What statistical approaches are appropriate for analyzing P2RY8 variant effects in human population studies?

Analyzing P2RY8 variants in human populations requires sophisticated statistical approaches to address various challenges:

  • Rare variant analysis methods:

    • Burden tests to assess cumulative impact of rare variants in P2RY8

    • Variance-component tests (e.g., SKAT, SKAT-O) for bidirectional effect variants

    • Combined approaches for optimal rare variant detection

    • Implementation example: A previous study identified multiple rare P2RY8 variants in lupus patients, including a de novo L257F variant associated with severe disease

  • Genotype-phenotype correlation analysis:

    • Mixed-effects models to account for related individuals in familial studies

    • Regression models incorporating disease severity metrics

    • Survival analysis for time-to-event outcomes (disease progression)

    • Application guidance: These approaches helped correlate P2RY8 expression levels with specific phenotypes such as lupus nephritis

  • Population stratification considerations:

    • Principal component analysis to identify population substructure

    • Stratified analysis based on ancestry

    • Admixture mapping when appropriate

    • Example implementation: Prior research noted population-specific frequencies of variants like E323G

  • Functional impact prediction integration:

    • Weighted analysis based on predicted functional impact scores

    • Machine learning approaches combining multiple prediction algorithms

    • Bayesian frameworks incorporating prior biological knowledge

    • Example methodology: Previous studies used PolyPhen, SIFT, and CADD scores (>12) to prioritize variants

  • Multiple testing correction strategies:

    • Region-based correction rather than genome-wide when focusing solely on P2RY8

    • False discovery rate control for exploratory analyses

    • Permutation-based methods for correlated tests

    • Implementation consideration: Appropriate when testing multiple variants or phenotype associations

These statistical approaches enable robust identification and characterization of clinically relevant P2RY8 variants in diverse patient populations.

How can researchers integrate P2RY8 findings with broader immune regulation pathways?

Integrating P2RY8 research into broader immune regulation contexts requires systematic approaches:

  • Pathway integration analysis:

    • Position P2RY8 signaling within known immune tolerance pathways:

      • B cell receptor signaling networks

      • Germinal center organization pathways

      • Plasma cell differentiation programs

    • Identify points of convergence and divergence with other regulatory mechanisms

    • Map interactions between P2RY8 and established tolerance mediators (e.g., FcγRIIB, CD22)

  • Multi-omics data integration:

    • Combine P2RY8-focused studies with:

      • Transcriptomics to identify co-regulated gene networks

      • Proteomics to map signaling networks

      • Epigenomics to understand regulatory mechanisms

    • Implement computational approaches (e.g., weighted gene co-expression network analysis)

    • Develop integrated models of P2RY8 function in immune regulation

  • Cross-disease comparative analysis:

    • Compare P2RY8 findings in lupus with other autoimmune conditions

    • Assess overlap with lymphoma pathogenesis (given P2RY8 variants in GC-derived lymphomas)

    • Identify common and disease-specific mechanisms

    • Develop a unified model of P2RY8 function across immune pathologies

  • Therapeutic target contextualization:

    • Position P2RY8 within the landscape of existing therapeutic targets

    • Assess potential for synergistic or antagonistic interactions with current therapies

    • Identify patient subsets most likely to benefit from P2RY8-targeted approaches

    • Consider P2RY8 pathway augmentation as a therapeutic strategy

  • Evolutionary and comparative immunology perspective:

    • Analyze P2RY8 conservation across species (human vs. chicken variants)

    • Compare function in different model organisms

    • Understand evolutionary pressures shaping receptor function

    • Leverage cross-species insights to understand fundamental mechanisms

This integrative approach positions P2RY8 research within the broader context of immune regulation and identifies its unique contributions to immune tolerance and autoimmunity.

What are the most promising approaches for therapeutic targeting of the P2RY8 pathway?

Based on current understanding of P2RY8 biology, several therapeutic targeting approaches show particular promise:

  • Pathway augmentation strategies:

    • Development of selective P2RY8 agonists to reinforce tolerance mechanisms

    • Stabilization of endogenous ligands (e.g., GGG) through inhibition of degradation pathways

    • Gene therapy approaches to restore P2RY8 expression in relevant B cell populations

    • Rationale: Research suggests augmenting P2RY8 signaling may have therapeutic potential in systemic autoimmune diseases

  • Targeting downstream effectors:

    • Modulation of RhoA signaling components specific to P2RY8 pathway

    • Selective inhibition of counterregulatory pathways that oppose P2RY8 function

    • Reinforcement of cytoskeletal regulation pathways that mediate P2RY8 effects on migration

    • Mechanistic basis: P2RY8 regulates B cell tolerance through effects on cell migration and the actin cytoskeleton

  • Cell-specific delivery approaches:

    • Targeted delivery to specific B cell subsets (e.g., immature B cells, germinal center B cells)

    • Development of antibody-drug conjugates directed to B cell surface markers

    • Nanoparticle-based delivery systems with B cell tropism

    • Application context: Different B cell subsets show variable P2RY8 expression and function

  • Combination therapeutic strategies:

    • Integration with existing B cell-targeted therapies

    • Synergistic approaches targeting multiple tolerance checkpoints

    • Personalized combinations based on patient-specific P2RY8 variant profiles

    • Clinical rationale: P2RY8 variants likely act in concert with other genetic or environmental risk factors

  • Biomarker-guided therapeutic approaches:

    • P2RY8 expression level assessment to identify patients likely to benefit

    • Genetic screening for P2RY8 variants to guide therapy selection

    • Monitoring of downstream signaling as pharmacodynamic markers

    • Implementation framework: Could align with the varying functional effects observed across different P2RY8 variants (L257F, N97K, E323G)

These therapeutic approaches offer potential new avenues for intervention in autoimmune diseases by leveraging P2RY8's role in maintaining B cell tolerance.

What experimental models would best advance understanding of P2RY8 in human disease?

Advancing P2RY8 research requires development and refinement of several key experimental models:

  • Humanized mouse models:

    • Mice expressing human P2RY8 variants in the B cell compartment

    • Patient-derived xenograft models for studying variant-specific effects

    • Conditional expression systems for temporal control of P2RY8 function

    • Research application: These models would address the suggestion in prior research that "future studies in humanized mouse models may help further delineate the sites of P2RY8 action in preventing systemic autoimmune disease"

  • Advanced in vitro systems:

    • 3D organoid cultures modeling lymphoid tissue microenvironments

    • Co-culture systems incorporating multiple immune cell types

    • Microfluidic systems to study migration in physiologically relevant gradients

    • Patient-derived B cell cultures maintaining critical in vivo properties

    • Methodological considerations: Overcome limitations of current in vitro systems that may not recapitulate the full complement of in vivo signaling contexts

  • Single-cell analytical platforms:

    • Single-cell RNA sequencing to resolve P2RY8-dependent transcriptional programs

    • Single-cell protein analysis to map signaling networks at individual cell resolution

    • Spatial transcriptomics to understand P2RY8 function in tissue context

    • Research application: Would help explain the heterogeneous expression of P2RY8 observed across B cell populations in lupus patients

  • CRISPR-engineered cellular models:

    • Isogenic cell lines with specific P2RY8 variants to isolate variant effects

    • Functional genomic screens to identify genetic modifiers of P2RY8 function

    • Base editing approaches for precise modeling of patient variants

    • Experimental advantage: Would provide cleaner systems to study mechanistic effects observed in complex patient samples

  • Longitudinal patient cohorts:

    • Prospective studies tracking P2RY8 expression and function over disease course

    • Integration with comprehensive clinical data collection

    • Serial sampling for functional and genomic analyses

    • Research value: Would extend current understanding of how P2RY8 correlates with disease manifestations like lupus nephritis

Development of these complementary model systems would enable more comprehensive investigation of P2RY8 biology in human disease contexts.

How might researchers address the knowledge gaps in P2RY8 ligand identification and receptor signaling?

Addressing critical knowledge gaps in P2RY8 biology requires targeted research approaches:

  • Comprehensive ligand identification strategies:

    • Unbiased screening approaches using metabolomic profiling

    • Comparative analysis with known ligands of related P2Y receptors

    • Structure-based virtual screening for potential ligands

    • Validation of candidate ligands using multiple functional readouts

    • Context from literature: GGG has been identified as a putative ligand, but additional endogenous ligands may exist

  • Receptor structure-function analysis:

    • Structural biology approaches (cryo-EM, X-ray crystallography)

    • Molecular dynamics simulations to understand conformational changes

    • Systematic mutagenesis to map critical signaling domains

    • Chimeric receptor approaches to identify domain-specific functions

    • Application to variants: Would help explain how variants like L257F disrupt receptor function

  • Signaling network mapping:

    • Phosphoproteomics to comprehensively identify downstream targets

    • Temporal signaling analysis at multiple time points post-stimulation

    • Interactome analysis to identify P2RY8-associated proteins

    • Systems biology approaches to model network dynamics

    • Research significance: Would expand current understanding beyond RhoA, AKT, and ERK pathways

  • Tissue and context-specific signaling analysis:

    • Investigation of P2RY8 function across different lymphoid compartments

    • Analysis of signaling under various activation conditions

    • Examination of receptor function during developmental transitions

    • Relevance to findings: Would help explain P2RY8's roles at multiple tolerance checkpoints

  • Receptor regulation mechanisms:

    • Investigation of transcriptional and post-transcriptional regulation

    • Analysis of receptor trafficking, internalization, and recycling

    • Examination of post-translational modifications affecting function

    • Research application: Would expand understanding of why P2RY8 is reduced in some SLE patients lacking gene variants

Addressing these knowledge gaps would significantly advance understanding of P2RY8 biology and potentially identify new therapeutic approaches for autoimmune diseases.

What are the best practices for designing site-directed mutagenesis studies of P2RY8?

Designing optimal site-directed mutagenesis studies for P2RY8 requires careful consideration of several methodological aspects:

  • Strategic mutation selection:

    • Target variants identified in patient populations (e.g., L257F, N97K, E323G)

    • Design mutations in conserved motifs across P2Y receptor family

    • Create systematic alanine scanning mutations across functional domains

    • Include both naturally occurring variants and rationally designed mutations

    • Methodological precedent: Previous studies successfully implemented QuickChange site-directed mutagenesis protocols to generate P2RY8 variants

  • Vector and expression system considerations:

    • Select appropriate vectors based on experimental goals:

      • GFP-tagged constructs for localization and trafficking studies

      • Flag-tagged constructs for protein interaction studies

      • Retroviral vectors for stable expression in primary cells

    • Choose expression systems that maintain receptor functionality

    • Technical guidance: Previous research utilized both IRES-GFP containing PMIGII vectors and IRES-Thy1.1 containing MSCV2.2 vectors

  • Validation of mutant constructs:

    • Sequence verification of the entire coding region

    • Assessment of expression levels relative to wild-type

    • Protein stability evaluation using degradation assays

    • Subcellular localization confirmation

    • Methodological approach: Protein degradation can be assessed using cycloheximide (100 μg/ml) exposure over time

  • Functional characterization strategy:

    • Implement parallel assays addressing multiple functional aspects:

      • SRF-luciferase assays for RhoA signaling

      • Phospho-flow cytometry for AKT/ERK activation

      • Migration assays for functional outcomes

      • Cell differentiation assays for developmental effects

    • Experimental design: Include wild-type and empty vector controls in all assays

  • Data analysis framework:

    • Normalize mutant receptor data to wild-type activity

    • Develop quantitative metrics for classification of variant effects

    • Create structure-function correlation maps

    • Implement statistical approaches appropriate for the specific assays

    • Analysis example: Previous work categorized variants as strong (L257F), intermediate (N97K), or mild (E323G) based on multiple functional readouts

Following these best practices ensures generation of high-quality, interpretable data on the functional impact of P2RY8 variants.

How should researchers optimize calcium mobilization assays for P2RY8 functional studies?

Optimizing calcium mobilization assays for P2RY8 studies requires attention to several critical parameters:

  • Fluorescent indicator selection and loading:

    • Use ratiometric calcium indicators (e.g., fura-2) for quantitative measurements

    • Optimize loading conditions (concentration, time, temperature)

    • Include proper controls for loading efficiency

    • Consider AM-ester versus direct loading approaches based on cell type

    • Methodological precedent: Fura-2 has been successfully used to study calcium mobilization in response to purinergic receptor activation

  • Experimental setup optimization:

    • Establish stable baseline measurements before stimulation

    • Determine optimal acquisition rates to capture rapid calcium transients

    • Calibrate system using known calcium standards

    • Implement temperature control for physiologically relevant conditions

    • Technical consideration: Microfluorimetric measurements provide single-cell resolution for heterogeneous responses

  • Stimulation protocols:

    • Determine optimal ligand concentration through dose-response curves

    • Implement precise delivery systems for consistent stimulation

    • Consider sequential stimulation protocols to assess receptor desensitization

    • Include positive controls (e.g., ATP, UTP) known to mobilize calcium

    • Experimental precedent: Brief application of 300 μM ATP or 300 μM UTP has been shown to cause transient increases in intracellular calcium for other P2Y receptors

  • Source discrimination strategies:

    • Differentiate between intracellular stores and extracellular calcium:

      • Use calcium-free external solutions with EGTA to isolate store release

      • Apply thapsigargin to deplete stores and isolate influx pathways

      • Implement specific channel blockers to identify influx mechanisms

    • Analytical approach: Compare calcium responses in normal and calcium-free conditions

  • Analysis and interpretation framework:

    • Quantify multiple parameters of calcium responses:

      • Peak amplitude

      • Area under curve

      • Rise time and decay kinetics

      • Response probability in cell populations

    • Correlate calcium signaling patterns with downstream functional outcomes

    • Integration with other methods: Combine with other signaling readouts (e.g., SRF-luciferase) for comprehensive pathway analysis

These optimization strategies enhance the reliability and interpretability of calcium mobilization assays for P2RY8 functional studies.

What are the critical considerations for developing and validating P2RY8 knockout and knockin models?

Development of genetically modified P2RY8 models requires attention to several critical factors:

  • Strategic targeting approach selection:

    • CRISPR/Cas9 system design:

      • Guide RNA selection for minimal off-target effects

      • Targeting strategy (exon disruption vs. whole gene deletion)

      • Repair template design for knockin models

    • Conditional systems for temporal and tissue-specific control:

      • Cre-loxP systems for B cell-specific deletion

      • Inducible promoters for temporal control

    • Methodological consideration: Complete versus hypomorphic alleles may reveal different aspects of P2RY8 biology

  • Validation of genetic modification:

    • Genomic verification:

      • PCR-based genotyping strategies

      • Sequencing of target regions and potential off-target sites

      • Copy number analysis for potential duplications

    • Expression confirmation:

      • mRNA assessment using RT-PCR and qPCR

      • Protein verification by western blot and flow cytometry

      • Functional validation using established P2RY8 readouts

    • Technical example: Previous studies utilized RT-PCR to confirm expression of purinergic receptor mRNA

  • Phenotypic characterization strategy:

    • Baseline immunological assessment:

      • B cell development and subset distribution

      • Germinal center formation and dynamics

      • Autoantibody production

    • Challenge models:

      • Immunization responses

      • Autoimmune disease induction

      • Aging-associated phenotypes

    • Experimental precedent: Previous studies examined the effect of P2RY8 expression on DNA-reactive B cell selection using the VH3H9 transgenic model

  • Controls and reference populations:

    • Littermate controls to minimize genetic background effects

    • Heterozygous models to assess gene dosage effects

    • Wild-type P2RY8 reconstitution controls

    • Comparisons with known autoimmune models

    • Implementation approach: Prior research used bone marrow chimeric mice with approximately one-fifth of B cells expressing P2RY8

  • Cross-validation with human data:

    • Correlation of model phenotypes with patient observations

    • Parallel analysis of variant effects in human and model systems

    • Validation of therapeutic targets identified in models

    • Research context: Mouse models should be designed to test hypotheses generated from human genetic studies of P2RY8 variants in lupus patients

Addressing these considerations ensures development of physiologically relevant and well-validated genetic models of P2RY8 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.