Recombinant Human p53 apoptosis effector related to PMP-22 (PERP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human p53 Apoptosis Effector Related to PMP-22 (PERP)

Recombinant Human p53 apoptosis effector related to PMP-22 (PERP) is a synthetic version of the PERP protein, a key mediator of p53-dependent apoptosis. This transmembrane protein is encoded by the PERP gene (chromosome 6q24) and is transcriptionally induced by p53 during programmed cell death, but not during cell cycle arrest . The recombinant form is engineered for research purposes, featuring tags for purification and detection .

Sequence and Functional Domains

The protein includes four transmembrane domains and shares structural similarity with PMP-22/gas3 family proteins . Key regions include:

  • Plasma membrane localization signals: Critical for apoptosis induction .

  • Caspase-8 activation sites: Linked to extrinsic apoptotic pathways .

Role in Apoptosis

PERP mediates p53-dependent apoptosis through distinct mechanisms:

  1. Caspase activation: Induces cleavage of pro-caspase-8 and Bid, initiating extrinsic apoptosis .

  2. p53 stabilization: Enhances nuclear retention and transcriptional activity of p53 by modulating MDM2 interactions .

  3. Desmosomal disruption: Loss of PERP correlates with reduced cell adhesion and tumor progression in squamous cell carcinomas .

Table 1: PERP-Dependent Apoptotic Pathways

PathwayMechanismEvidence
Extrinsic ApoptosisCaspase-8 activation → Bid cleavage → Mitochondrial apoptosis
p53-MDM2 RegulationNuclear retention of p53 → Transcriptional activation of pro-apoptotic genes
Hippo-YAP/TAZ-p73 AxisReprimo-mediated extrinsic apoptosis (p53-independent)

Tumor Suppression

PERP acts as a tumor suppressor by:

  • Limiting metastasis: Downregulated in aggressive uveal melanomas (monosomy 3 subtype) and squamous cell carcinomas .

  • Promoting desmosomal integrity: Maintains epithelial barrier function; loss triggers inflammation and tumorigenesis .

Functional Studies in Cancer Models

Cancer TypePERP RoleOutcome
Uveal MelanomaApoptosis induction via caspase-8 activationReduced tumor growth
Skin CarcinomaDesmosomal maintenance → Inhibition of SCC progressionDelayed tumor onset
Breast/Ovarian CancersDownregulation correlates with metastatic potentialPoor prognosis

Recombinant PERP in In Vitro Systems

  • Transfection efficiency: ~13% in transiently transfected UM cells, sufficient to elevate p53 levels .

  • Dose-dependent effects: Higher PERP expression increases cleaved caspase-8 and reduces Bid protein .

Biomarker Potential

  • Prognostic value: Low PERP expression in primary tumors predicts aggressive disease (e.g., uveal melanoma, squamous cell carcinoma) .

  • Therapeutic target: Enhancing PERP activity may restore p53 function in cancers with wild-type p53 .

Challenges and Future Directions

  • Delivery: Recombinant PERP requires optimization for in vivo stability and tumor targeting.

  • Synergy: Combining PERP with p53-activating agents (e.g., MDM2 inhibitors) to amplify apoptotic responses .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Please note: If you have a specific requirement for the glycerol content, kindly specify it when placing your order.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.

Form
Available in Liquid or Lyophilized powder formats.
Note: We will prioritize shipping the format currently in stock. However, if you have a specific preference for the format, please indicate your requirement during order placement. We will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Synonyms
PERP; KCP1; KRTCAP1; PIGPC1; THW; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1; P53-induced protein PIGPC1; Transmembrane protein THW
Datasheet & Coa
Please contact us to get it.
Expression Region
1-193aa
Mol. Weight
41.4kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
PERP, p53 apoptosis effector related to PMP-22, is an integral component of intercellular desmosome junctions. It plays a crucial role in maintaining the integrity of stratified epithelial tissues and promoting cell-cell adhesion by facilitating desmosome assembly. Furthermore, PERP acts as an effector in the TP53-dependent apoptotic pathway, contributing to programmed cell death.
Gene References Into Functions
  1. Downregulation of desmosomal formation transcripts, including PERP, may contribute to the aggressive phenotype observed in sparsely granulated GH pituitary tumors and their behavior in response to surgery and medical therapy. PMID: 28323918
  2. Expression of p63-tGFP induces apoptosis with a marked increase in PERP expression and associated p53 accumulation. Conversely, the absence of p63 leads to reduced PERP levels and impaired p53-mediated apoptosis in UM. PMID: 27584665
  3. Salmonella Typhimurium type III secreted effector SipC significantly contributes to the redistribution of PERP to the apical membrane surface. PMID: 27078059
  4. Researchers have identified the tetraspanning membrane protein, PERP, as a binding partner for Salmonella typhimurium SipA. PMID: 25486861
  5. Decreased PERP expression on peripheral blood mononuclear cells from patients with rheumatoid arthritis demonstrates a negative correlation with disease activity. PMID: 24066004
  6. Human breast cancer cell lines exhibit reduced PERP expression. PMID: 22515648
  7. PERP expression stabilizes active p53 by modulating the interaction between p53 and MDM2 in uveal melanoma cells. PMID: 21451571
  8. Comprehensive mutation scanning has not identified any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations. PMID: 21254927
  9. Research suggests a temporal sequence where PERP loss occurs prior to E-cadherin loss in the progression of human SCC. PMID: 20975948
  10. Findings highlight the apoptotic pathway mediated by PERP as a critical mechanism employed by uveal melanoma tumors to modulate their susceptibility to apoptosis. PMID: 19040420
  11. Pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, ultimately leading to its degradation in the lysosome. PMID: 19158843
  12. Studies have shown that PERP induction is compromised with some, but not all, Ankyloblepharon Ectodermal Dysplasia and Cleft Lip/Palate, AEC-patient derived TP63 mutants. PMID: 19353588
  13. A study identified Perp (p53 Apoptosis Effector Related to PMP22) as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530

Show More

Hide All

Database Links

HGNC: 17637

OMIM: 609301

KEGG: hsa:64065

STRING: 9606.ENSP00000397157

UniGene: Hs.201446

Protein Families
TMEM47 family
Subcellular Location
Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.

Q&A

What is the molecular structure and cellular localization of PERP?

PERP is a transmembrane protein with a molecular weight of 41.4kDa that localizes to the plasma membrane in cells. The full-length human PERP protein consists of 193 amino acids with a sequence beginning with "MIRCGLACER CRWILPLLLL SAIAFDIIAL..." and continuing through its transmembrane domains . Studies using full-length PERP-green fluorescent protein (GFP) fusions and real-time confocal microscopy have demonstrated the intracellular targeting and plasma membrane localization of PERP in living uveal melanoma cells . The protein contains multiple transmembrane domains consistent with its role in membrane-associated signaling processes. When conducting immunofluorescence or cellular fractionation experiments, researchers should focus on membrane fractions rather than cytosolic components to accurately detect PERP localization.

What are the known functions of PERP in cellular processes?

PERP functions primarily as an effector in the p53-dependent apoptotic pathway. Time course analysis experiments revealed that PERP expression increases significantly during apoptosis compared to G1 arrest, with high-level PERP expression correlating directly with cell death induction . Approximately 21% of cells undergo apoptosis by 16 hours post-treatment in experimental models where PERP is upregulated . Importantly, PERP is not generally induced in all contexts of apoptosis in fibroblasts but is specifically linked to p53-dependent apoptotic responses. For example, when p53-deficient mouse embryonic fibroblasts (MEFs) expressing E1A/ras are treated with TNFα to induce p53-independent apoptosis, no increase in PERP RNA levels is observed despite the induction of cell death . This specificity makes PERP an important biomarker for distinguishing between p53-dependent and p53-independent apoptotic pathways in experimental designs.

How is PERP expression regulated at the transcriptional level?

PERP is transcriptionally regulated as a direct target of the p53 tumor suppressor. Analysis of the PERP promoter reveals that its transcription is specifically activated during apoptosis rather than cell cycle arrest . When designing experiments to study PERP expression, researchers should consider the following methodological approaches:

  • Use doxorubicin (0.2 μg/ml) treatment in p53+/+ cells to induce PERP expression through DNA damage response

  • Compare expression levels between apoptotic and G1-arrested cell populations to observe differential regulation

  • Include p53-/- cells as negative controls to verify p53-dependence of expression

  • Perform time course analyses to track PERP expression kinetics following apoptotic stimuli

Northern blot or qPCR analysis typically reveals moderate induction of PERP during G1 arrest but significantly higher levels during apoptosis in p53-competent cells. No significant expression is observed in p53-deficient cells, confirming the strict p53-dependence of PERP transcription .

What experimental approaches are optimal for studying PERP-induced apoptosis mechanisms?

When investigating the mechanisms of PERP-induced apoptosis, researchers should employ multiple complementary approaches to characterize both the pathway and its regulation. The following methodological framework is recommended:

  • Expression Systems and Visualization:

    • Utilize full-length PERP-GFP fusion constructs for real-time monitoring of protein localization and trafficking in living cells

    • Apply confocal microscopy to track membrane integration and potential redistribution during apoptosis

  • Apoptotic Pathway Characterization:

    • Measure activation of caspases (particularly caspase-3, -8, and -9) using fluorogenic substrates or immunoblotting for cleaved forms

    • Investigate the association between PERP expression levels and caspase activation through correlation analysis

    • Employ caspase inhibitors (pan-caspase or specific) to determine dependency of PERP-induced cell death on caspase activation

  • Temporal Analysis:

    • Design time-course experiments following PERP induction to establish the sequence of molecular events

    • Monitor both early (phosphatidylserine externalization) and late (DNA fragmentation) apoptotic markers

Studies in uveal melanoma cells have demonstrated a strong association between PERP expression levels and caspase activation, both in vitro and in primary tumor samples, indicating that PERP-induced apoptosis proceeds through the classical caspase-dependent pathway .

How can researchers differentiate between PERP's roles in p53-dependent versus p53-independent apoptotic contexts?

Distinguishing PERP's specific role in p53-dependent apoptosis from other apoptotic pathways requires careful experimental design:

  • Cell System Selection:

    • Use matched p53+/+ and p53-/- cell lines (e.g., MEFs) to directly compare responses

    • Include E1A-expressing cells for enhanced apoptotic sensitivity and p53-deficient cells with alternative apoptotic triggers (e.g., TNFα)

  • Apoptotic Stimuli Comparison:

    • DNA damage agents (doxorubicin at 0.2 μg/ml, UV radiation at 20 J/m²) to activate p53-dependent pathways

    • Death receptor ligands (TNFα at 20 ng/ml) to activate p53-independent pathways

  • Expression Analysis:

    • Quantify PERP mRNA levels via qPCR or Northern blotting at multiple timepoints post-treatment

    • Correlate PERP expression with apoptotic index measured by flow cytometry or TUNEL assay

  • Genetic Manipulation:

    • Use PERP knockdown/knockout approaches in p53-competent cells to assess necessity for apoptosis

    • Perform PERP overexpression in p53-deficient cells to test sufficiency for apoptosis induction

Research has demonstrated that while PERP expression increases dramatically in p53+/+ cells undergoing apoptosis after DNA damage, no significant induction occurs in p53-/- cells, even as they begin to undergo apoptosis through alternative mechanisms . Furthermore, when p53-/- cells are treated with TNFα to induce p53-independent apoptosis, PERP RNA levels remain low despite cell death induction, confirming PERP's specificity to the p53 apoptotic pathway .

What are the methodological considerations for using recombinant PERP protein in experimental systems?

When utilizing recombinant human PERP protein for experimental applications, researchers should consider several critical factors:

  • Protein Characteristics and Quality Control:

    • Source verification: Recombinant human PERP is typically produced in E. coli expression systems with purification tags (e.g., N-Terminal 10xHis-Sumo-Tag and C-Terminal Myc-Tag)

    • Purity assessment: Verify >85% purity via SDS-PAGE before experimental use

    • Storage conditions: Maintain at -20°C and avoid repeated freeze/thaw cycles to preserve protein integrity

  • Experimental Application Methods:

    • For cellular uptake studies, consider that PERP is a transmembrane protein requiring appropriate delivery systems

    • When reconstituting lyophilized protein, use the recommended Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For storage of liquid formulations, use Tris/PBS-based buffer with 5-50% glycerol

  • Functional Verification:

    • Before proceeding with complex experiments, confirm protein activity through established assays

    • Use immunofluorescence to verify proper membrane localization when introduced to cells

    • Perform dose-response experiments to determine optimal concentrations for biological effects

  • Controls and Comparisons:

    • Include non-functional PERP mutants or heat-inactivated protein as negative controls

    • Compare effects with other apoptosis-inducing agents to position PERP in the apoptotic cascade

The recombinant PERP protein (full length 1-193aa) has a molecular weight of 41.4kDa and contains the complete sequence necessary for its transmembrane function and apoptotic activity .

How is PERP expression altered in cancer and what are the implications for research methodology?

PERP expression patterns show significant alterations in various cancer types, with particularly well-documented changes in uveal melanoma (UM). When designing studies to investigate PERP in cancer contexts, researchers should consider:

  • Expression Analysis in Tumor Samples:

    • In primary uveal melanoma, PERP expression is down-regulated in the metastatic monosomy 3-type tumors compared to less aggressive disomy 3-type tumors

    • Use quantitative methodologies (qPCR, Western blot) with appropriate normalization to accurately measure expression differences

    • Compare expression between tumor and matched normal tissue whenever possible

  • Functional Assessment in Cancer Cell Models:

    • When introducing PERP into cancer cell lines, monitor:

      • Changes in apoptotic susceptibility

      • Alterations in caspase activation pathways

      • Effects on proliferation and invasion capabilities

  • Genetic and Epigenetic Regulation Analysis:

    • Investigate promoter methylation status of PERP in tumor samples

    • Assess potential mutations in the PERP gene or its regulatory regions

    • Examine the status of p53 and its pathway components in relation to PERP expression

  • Therapeutic Targeting Considerations:

    • Test whether restoring PERP expression sensitizes resistant cancer cells to apoptosis-inducing therapies

    • Develop screening assays for compounds that specifically upregulate PERP expression

Research has demonstrated that PERP expression strongly correlates with caspase activation in both uveal melanoma cells in vitro and in primary uveal melanoma tumors, suggesting that PERP downregulation contributes to apoptosis resistance in aggressive tumors . This relationship provides a potential therapeutic vulnerability that could be exploited in cancer treatment strategies.

What experimental designs are most effective for studying PERP's role in uveal melanoma progression?

To effectively investigate PERP's contribution to uveal melanoma development and progression, researchers should implement multi-faceted experimental designs:

  • Cell Line Models and Manipulations:

    • Use multiple uveal melanoma cell lines representing different genetic backgrounds

    • Create stable PERP-expressing and PERP-knockdown cell lines using lentiviral systems

    • Apply PERP-GFP fusion constructs to track localization in real-time

  • Functional Assays:

    • Apoptosis assessment: Measure caspase activation, Annexin V binding, and DNA fragmentation

    • Migration and invasion assays to determine effects on metastatic potential

    • Tumor sphere formation to assess cancer stem cell properties

  • Molecular Pathway Analysis:

    • Examine relationships between PERP expression and:

      • p53 pathway components

      • Chromosome 3 status (monosomy vs. disomy)

      • Other apoptotic regulators

  • In Vivo Models:

    • Xenograft experiments comparing tumors with different PERP expression levels

    • Metastasis models to assess the impact on dissemination

    • Preclinical testing of therapies targeting PERP or its regulatory mechanisms

Studies have established that expression of PERP induces caspase-mediated apoptosis in uveal melanoma cells, with a strong association between PERP expression levels and caspase activation both in vitro and in primary tumors . This suggests that loss of PERP expression may be an important mechanism by which uveal melanoma cells evade apoptosis, particularly in the more aggressive monosomy 3-type tumors.

What are the key elements of a well-designed experiment investigating PERP function?

When designing experiments to investigate PERP function, researchers should incorporate these methodological elements:

  • Cellular Models Selection:

    • Include both p53-proficient and p53-deficient cell lines to distinguish p53-dependent effects

    • Use primary cells where possible (e.g., MEFs, thymocytes) alongside established cell lines

    • Consider cell types where PERP has demonstrated functions (fibroblasts, thymocytes, neurons, and zebrafish embryos)

  • Experimental Control Design:

    • Proper negative controls: vector-only, non-functional PERP mutants

    • Positive controls: established apoptosis inducers (doxorubicin at 0.2 μg/ml, UV radiation at 20 J/m²)

    • Internal controls: housekeeping gene expression, non-regulated proteins

  • Temporal Considerations:

    • Perform time course analyses to establish:

      • Kinetics of PERP induction (typically observable within 8-16 hours post-stimulus)

      • Sequence of downstream events (caspase activation, apoptotic morphology)

      • Correlation between PERP expression levels and percentage of apoptotic cells

  • Quantitative Measurements:

    • Use absolute quantification where possible for PERP mRNA and protein levels

    • Apply multiple apoptosis detection methods (e.g., Annexin V/PI staining, caspase activity assays, TUNEL)

    • Perform statistical analyses appropriate for the experimental design (e.g., ANOVA for multi-group comparisons)

Studies implementing these design elements have successfully characterized PERP's role in apoptosis across multiple cellular contexts and identified its specific connection to p53-dependent cell death pathways .

How should researchers approach data contradictions in PERP studies across different cellular contexts?

When encountering contradictory data regarding PERP function across different cellular contexts, researchers should implement systematic approaches to resolve discrepancies:

  • Methodological Reconciliation:

    • Compare experimental conditions in detail (cell types, treatments, timepoints, detection methods)

    • Standardize key protocols across research groups to improve comparability

    • Implement multiple detection methods within the same experiment to verify findings

  • Biological Context Analysis:

    • Assess p53 status and functionality in each cellular system

    • Evaluate expression of PERP-interacting proteins or pathway components

    • Consider cell-type specific factors that might influence PERP function

  • Integrated Data Approach:

    • Develop a hierarchical framework categorizing results by:

      • Reliability of experimental system

      • Consistency across independent studies

      • Alignment with established biological principles

    • Generate testable hypotheses to explain context-dependent differences

  • Resolution Experiments:

    • Design experiments specifically to address contradictions

    • Use genetic rescue approaches to test specificity of observations

    • Apply systems biology approaches to map context-dependent networks

For example, while PERP induces apoptosis in multiple cellular contexts, its regulation and exact mechanism may differ. In fibroblasts, PERP is specifically induced during p53-dependent apoptosis but not during G1 arrest , whereas in uveal melanoma cells, PERP induction leads to caspase-mediated apoptosis that may involve additional context-specific factors . These differences should be explicitly addressed when designing experiments and interpreting results.

What are the optimal methods for detecting and quantifying PERP protein and mRNA in experimental samples?

For accurate detection and quantification of PERP at both protein and mRNA levels, researchers should employ these methodological approaches:

  • mRNA Detection and Quantification:

    • qRT-PCR with carefully validated primers spanning exon-exon junctions

    • Northern blot analysis for size verification and semi-quantitative assessment

    • RNA-Seq with appropriate depth of coverage for comprehensive transcriptome analysis

    • In situ hybridization for tissue localization studies

  • Protein Detection and Quantification:

    • Western blot analysis using validated antibodies against PERP or epitope tags

    • Flow cytometry for quantification at the single-cell level

    • Immunofluorescence microscopy for localization studies

    • ELISA for quantitative assessment in complex samples

  • Technical Considerations:

    • For membrane proteins like PERP, sample preparation is critical:

      • Use appropriate lysis buffers containing detergents suitable for membrane protein extraction

      • Consider membrane fractionation to enrich for PERP

      • For immunofluorescence, permeabilization conditions must be optimized

  • Validation Approaches:

    • Include positive controls (PERP-overexpressing cells) and negative controls (PERP knockout cells)

    • Verify antibody specificity using multiple techniques

    • Use tagged PERP constructs (GFP, His, Myc) for detection when antibodies are limiting

Time course studies typically show PERP mRNA induction within 8-16 hours following p53-activating treatments, with higher expression in apoptotic versus G1-arrested cells . Protein detection should ideally capture both total cellular levels and membrane-localized fractions to fully characterize PERP dynamics.

How can researchers effectively manipulate PERP expression for functional studies?

To successfully manipulate PERP expression for functional studies, researchers should consider these methodological approaches:

  • Overexpression Strategies:

    • Transient transfection with plasmid vectors containing full-length PERP cDNA

    • Stable cell line generation using selection markers

    • Inducible expression systems (tetracycline-controlled, etc.) for temporal control

    • Viral vectors (lentivirus, adenovirus) for difficult-to-transfect cells

  • Knockdown/Knockout Approaches:

    • siRNA or shRNA targeting PERP mRNA for transient or stable knockdown

    • CRISPR-Cas9 gene editing for complete knockout

    • Antisense oligonucleotides for specific targeting

    • Dominant-negative mutants to interfere with endogenous PERP function

  • Fusion Proteins and Tags:

    • PERP-GFP fusions for visualization and tracking

    • Epitope tags (His, Myc, FLAG) for detection and purification

    • Split-reporter systems to study protein interactions

  • Validation of Manipulation:

    • Confirm alterations at both mRNA and protein levels

    • Verify subcellular localization of expressed protein

    • Assess functional consequences through apoptosis assays

    • Compare effects across multiple cell types

Studies employing PERP-GFP fusion proteins have successfully demonstrated plasma membrane localization in living uveal melanoma cells and confirmed that expression of PERP induces caspase-mediated apoptosis . When designing PERP expression constructs, researchers should consider that the recombinant human PERP protein contains 193 amino acids with a molecular weight of 41.4kDa and requires proper targeting signals for membrane localization .

What are the most promising future research directions for understanding PERP functions and applications?

The current understanding of PERP as a p53-dependent apoptosis effector opens several promising research directions:

  • Mechanistic Investigations:

    • Detailed characterization of PERP's membrane interactions and potential binding partners

    • Elucidation of the complete signaling pathway from PERP activation to caspase activation

    • Investigation of potential non-apoptotic functions in cell adhesion or other processes

  • Translational Applications:

    • Development of PERP-based biomarkers for cancer prognosis, particularly in uveal melanoma

    • Therapeutic strategies targeting PERP expression or function in cancer treatment

    • Screening platforms for compounds that can restore PERP expression in resistant tumors

  • System-Level Integration:

    • Multi-omics approaches to position PERP within broader cellular networks

    • Comparative studies across tissue types to understand context-specific regulation

    • In vivo models to validate PERP functions in physiological and pathological settings

  • Methodological Advancements:

    • Development of high-throughput approaches for PERP functional analysis

    • Advanced imaging techniques to track PERP dynamics in real-time within living systems

    • Computational models predicting PERP activity based on cellular context

The strong association between PERP expression levels and caspase activation in both uveal melanoma cells and primary tumors suggests that PERP could serve as both a prognostic biomarker and therapeutic target. Furthermore, the demonstration that PERP is specifically linked to p53-dependent apoptosis rather than being generally induced in all apoptotic contexts highlights its potential as a selective mediator for targeted therapeutic interventions.

How can researchers address current technical challenges in studying PERP functions?

Several technical challenges exist in PERP research that require innovative approaches:

  • Membrane Protein Analysis Limitations:

    • Implement advanced membrane protein extraction techniques

    • Use native PAGE approaches to preserve protein-protein interactions

    • Apply proximity labeling methods to identify interaction partners in intact cells

    • Develop improved antibodies specifically validated for different applications

  • Temporal Dynamics Detection:

    • Apply live-cell imaging with fluorescent PERP fusion proteins

    • Implement biosensors to monitor PERP activity in real-time

    • Use single-cell analysis to capture heterogeneity in PERP responses

    • Develop computational tools to analyze dynamic patterns of expression

  • Functional Redundancy Assessment:

    • Design combinatorial genetic approaches targeting PERP and related proteins

    • Use systems biology approaches to map redundant pathways

    • Implement synthetic lethality screens to identify context-dependent requirements

  • Translational Barriers:

    • Develop improved animal models recapitulating human PERP biology

    • Create patient-derived organoids to study PERP in disease contexts

    • Implement machine learning approaches to predict PERP activity from complex datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.