Recombinant Human Palmitoyltransferase ZDHHC13 (ZDHHC13)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Substrates

ZDHHC13 palmitoylates diverse proteins, influencing mitochondrial dynamics, autophagy, bone development, and neurodegenerative disease pathways.

Key Substrates and Processes

SubstrateFunction/PathwayExperimental EvidenceSource
Drp1Mitochondrial fission/fusion dynamics; regulates bioenergetics and neurotransmissionLoss of ZDHHC13 causes mitochondrial fragmentation
ULK1Autophagy initiation; recruits ULK1 complex to autophagosome formation sitesPalmitoylation required for ATG14L phosphorylation
MT1-MMPBone remodeling; regulates VEGF and osteocalcin expression in osteoblastsZdhhc13 mutant mice show osteoporosis
HuntingtinModulates protein aggregation in Huntington’s disease (HD)ZDHHC13 deficiency linked to HD neuropathology
CTNND1Adipogenic regulation; palmitoylation affects lipid raft localizationConfirmed via acyl-biotin exchange (ABE) assay

Mechanistic Insights

  • Autoacylation: ZDHHC13 undergoes autoacylation at its DHHC motif before transferring palmitate to substrates .

  • Substrate Specificity: The ANK (ankyrin repeat) domain in ZDHHC13 may mediate substrate recognition, as observed in other DHHC PATs .

Research Applications and Methodologies

Recombinant ZDHHC13 is employed in biochemical assays to study S-palmitoylation dynamics and substrate interactions.

Experimental Approaches

MethodApplicationOutcomeSource
Acyl-Biotin ExchangeIdentifies palmitoylated proteins in cellular lysatesQuantifies ZDHHC13-dependent palmitoylation
Co-IP and Mass SpecMaps ZDHHC13 substrates in vivo (e.g., ULK1, Drp1)Confirms direct interaction and palmitoylation
CRISPR KnockoutAssesses ZDHHC13’s role in autophagy (e.g., LC3 puncta formation defects)Reduced autophagy flux in ZDHHC13 KO cells
Chemical GeneticsUses bumped probes and mutant ZDHHC13 to map substrates (e.g., IFITM3)Identifies >300 ZDHHC-specific substrates

Disease Relevance and Therapeutic Potential

ZDHHC13 dysregulation is implicated in:

  • Huntington’s Disease: Palmitoylation of huntingtin by ZDHHC13 may modulate protein aggregation .

  • Osteoporosis: MT1-MMP palmitoylation defects in Zdhhc13 mutants disrupt bone remodeling .

  • Metabolic Disorders: Altered mitochondrial dynamics in ZDHHC13-deficient brains lead to glycolysis/glutaminolysis imbalances .

Table 1: ZDHHC13 Substrate-Specific Palmitoylation

SubstratePalmitoylation SiteFunctional ImpactMethodSource
Drp1Cysteine residuesMitochondrial fission/fusion imbalanceABE assay
ULK1Cysteine residuesAutophagosome formation defectsCRISPR knockout + IF
MT1-MMPCys574Reduced VEGF/osteocalcin expression in boneMutagenesis + ABE

Table 2: ZDHHC13 Production and Quality Control

ParameterSpecificationSource
Expression SystemE. coli (BL21(DE3))
PurificationNi-NTA affinity chromatography
Activity ValidationAutoacylation confirmed via YnPal labeling; substrate transfer tested in vitro

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZDHHC13; HIP14L; HIP3RP; Palmitoyltransferase ZDHHC13; Huntingtin-interacting protein 14-related protein; HIP14-related protein; Huntingtin-interacting protein HIP3RP; Putative MAPK-activating protein PM03; Putative NF-kappa-B-activating protein 209; Zinc finger DHHC domain-containing protein 13; DHHC-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC13
Target Protein Sequence
MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYG IFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVKFYISKGAVVDQLGGDLNSTPL HWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAG SSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSV ITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIF MTWFILFFPDLAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETG SLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSM VCGWIIYGSFIYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLN QLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCV VDWTSQYTMVFHPAREKVLRSV
Uniprot No.

Target Background

Function
Recombinant Human Palmitoyltransferase ZDHHC13 (ZDHHC13) is a palmitoyltransferase that catalyzes the addition of palmitic acid to various protein substrates. It functions as a palmitoyltransferase for huntingtin (HTT) and glutamate decarboxylase 2 (GAD2) and may play a role in magnesium ion (Mg2+) transport.
Gene References Into Functions
  1. This study demonstrates that ZDHHC13 defects lead to various phenotypes in mice, including non-thyroidal hypermetabolism, mitochondrial dysfunction, and abnormal lipid metabolism. PMID: 28526873
  2. Altered HIP14-HTT and HIP14L-HTT interactions in the presence of Huntington's disease mutations reduce palmitoylation and promote HTT and other HIP14/HIP14L substrate mislocalization. PMID: 25849918
  3. Deletion of huntingtin protein (HTT) amino acids 1-427 abolishes HTT interaction with palmitoyl acyltransferases huntingtin interacting protein 14 (HIP14) and huntingtin interacting protein 14-like (HIP14L). PMID: 24651384
  4. HIP14 and HIP14L, encoding Mg2+ transport proteins, are regulated by their inherent palmitoyl acyltransferases, exhibiting "chanzyme" characteristics. PMID: 18794299
Database Links

HGNC: 18413

OMIM: 612815

KEGG: hsa:54503

STRING: 9606.ENSP00000400113

UniGene: Hs.188569

Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Palmitoyltransferase ZDHHC13?

Palmitoyltransferase ZDHHC13 (also known as HIP14L) is a critical enzyme belonging to the ZDHHC family that catalyzes protein S-palmitoylation, a post-translational modification where a 16-carbon palmitate is covalently attached to a specific cysteine residue via a thioester linkage. This modification significantly enhances protein hydrophobicity, affects protein membrane association, and alters protein subcellular localization, thereby regulating diverse biological functions . ZDHHC13 undergoes a two-step catalytic process: first, it becomes autoacylated by palmitoyl-CoA to generate an acylated enzyme, and subsequently, in a transpalmitoylation step, it transfers the palmitoyl group to the substrate protein . Research has demonstrated that ZDHHC13 deficiency in mice results in severe phenotypes including amyloidosis, alopecia, osteoporosis, abnormal liver function, lipid abnormalities, and hypermetabolism, highlighting its essential role in normal physiological processes . Furthermore, ZDHHC13 has been identified as an important regulator of mitochondrial activity, particularly in the liver, where it influences metabolism and energy production through palmitoylation of key mitochondrial proteins .

Which proteins are known substrates of ZDHHC13?

ZDHHC13 has been shown to palmitoylate numerous protein substrates, reflecting its diverse biological functions. Through quantitative proteomics approaches, researchers have identified hundreds of potential ZDHHC13 substrates. A site-specific quantitative study using alkylating resin-assisted capture and mass spectrometry-based label-free strategy revealed that out of 2,190 S-palmitoylated peptides (corresponding to 883 S-palmitoylated proteins) identified in liver tissue, approximately 400 S-palmitoylation sites on 254 proteins were down-regulated in Zdhhc13-deficient mice, representing potential ZDHHC13 substrates . Among these confirmed specific substrates are MCAT (malonyl CoA-acyl carrier protein transacylase) and CTNND1 (catenin delta-1), which are critical for mitochondrial function and cell adhesion, respectively . Drp1 (Dynamin-related protein 1) has also been validated as a ZDHHC13 substrate, with direct Zdhhc13-Drp1 protein interaction observed both in vitro and in vivo . The palmitoylation of Drp1 by ZDHHC13 is essential for normal mitochondrial dynamics, particularly the fission-fusion process that maintains mitochondrial morphology and distribution . Additionally, the melanocortin-1 receptor (MC1R) has been identified as another important ZDHHC13 substrate, with implications for melanoma risk in individuals with red hair color (RHC) variants .

How does ZDHHC13 deficiency affect cellular and organismal physiology?

ZDHHC13 deficiency manifests in multiple physiological disruptions across various tissues and biological systems. In mice carrying a spontaneous Zdhhc13 recessive mutation (luc mice), researchers observed significant behavioral abnormalities at 3 months of age, including increased sensorimotor gating, anxiety, hypoactivity, and decreased motor coordination compared to littermate controls . These behavioral phenotypes correlate with altered neurotransmitter balances and disrupted synaptic structures in the brain . At the cellular level, ZDHHC13 deficiency leads to abnormal mitochondrial dynamics and morphology due to reduced S-palmitoylation of critical mitochondrial proteins such as Drp1 . This results in impaired mitochondrial function, including decreased ATP production and a metabolic shift toward increased glycolysis, glutaminolysis, and lactic acidosis . In the liver specifically, Zdhhc13-deficient mice exhibit abnormal liver function and lipid metabolism disturbances . Additionally, these mice develop severe phenotypes including amyloidosis, alopecia, and osteoporosis, highlighting the widespread physiological importance of ZDHHC13-mediated protein palmitoylation . The metabolic impact of ZDHHC13 deficiency is particularly pronounced, with affected mice displaying hypermetabolism and altered lipid profiles, attributed to the dysregulation of multiple metabolic pathways dependent on properly palmitoylated proteins .

What signaling pathways involve ZDHHC13-dependent protein palmitoylation?

ZDHHC13 participates in multiple signaling pathways through the palmitoylation of key proteins involved in signal transduction. One significant pathway involves the melanocortin-1 receptor (MC1R), whose signaling is critically dependent on palmitoylation primarily mediated by ZDHHC13 . In this pathway, AMPK (AMP-activated protein kinase) phosphorylates ZDHHC13 at S208, strengthening the interaction between ZDHHC13 and MC1R, particularly the red hair color (RHC) variants, which enhances MC1R palmitoylation and downstream signaling . This signaling cascade is crucial for DNA damage repair and melanoma prevention, with AMPK activation and MC1R palmitoylation repressing UVB-induced transformation of human melanocytes . Another essential pathway influenced by ZDHHC13 involves mitochondrial dynamics through the palmitoylation of Drp1, a protein critical for mitochondrial fission . The Zdhhc13-dependent Drp1 S-palmitoylation enables normal fission-fusion processes, which are vital for maintaining proper mitochondrial morphology, distribution, and function . Disruption of this pathway due to ZDHHC13 deficiency affects not only mitochondrial ATP production but also neurotransmission and integrity of synaptic structures in the brain, contributing to behavioral abnormalities . Additionally, ZDHHC13 has been linked to Huntington's disease (HD) pathology through its interaction with and palmitoylation of the huntingtin (Htt) protein, suggesting its involvement in pathways relevant to neurodegenerative disorders .

What are the most effective methods for detecting ZDHHC13-mediated protein palmitoylation?

Several sophisticated techniques have been developed for detecting and quantifying ZDHHC13-mediated protein palmitoylation, each with specific advantages for different research contexts. The acyl-biotin exchange (ABE) assay is a widely used method that has successfully demonstrated significant loss of palmitoylated proteins in both cytosolic and mitochondrial membrane fractions of ZDHHC13-deficient mice . This technique involves exchanging palmitoyl modifications with biotin, allowing for subsequent detection and isolation of previously palmitoylated proteins. For a more comprehensive analysis of the S-palmitoylome, researchers have implemented an integrated approach combining alkylating resin-assisted capture with mass spectrometry-based label-free quantification . This method enabled the identification of 2,190 S-palmitoylated peptides corresponding to 883 S-palmitoylated proteins in liver tissue, providing unprecedented insight into the scope of ZDHHC13 substrates . To normalize palmitoylation levels against protein expression changes, TMT10-plex labeling of the membrane proteome can be employed alongside palmitoylation detection, allowing researchers to distinguish between reduced palmitoylation and reduced protein expression . For investigating specific substrate-enzyme interactions, in vitro palmitoylation assays using recombinant ZDHHC13 and candidate substrates can provide direct evidence of palmitoylation activity. Additionally, an innovative strategy for identifying enzyme-specific substrates involves engineering orthogonal enzyme-substrate pairs through the pairing of synthetic fatty acyl CoA analogs with mutant ZDHHC enzymes, allowing for selective identification of substrates for a specific ZDHHC enzyme among the 23 family members that often have overlapping specificities .

How can researchers generate functional recombinant ZDHHC13 protein for in vitro studies?

Generating functional recombinant ZDHHC13 protein presents unique challenges due to its multiple transmembrane domains and the requirement for proper folding to maintain enzymatic activity. For in vitro kinase assays and other biochemical studies, GST-tagged ZDHHC13 has been successfully expressed in bacterial systems and purified for functional analysis . When studying ZDHHC13 interactions with specific substrates or regulatory proteins, researchers have employed both bacterial and mammalian expression systems depending on the experimental requirements. For structural studies, a high-resolution structure of human ZDHHC20 (a related ZDHHC family member) with 2-bromopalmitate has been achieved, providing insights into the fatty acyl-binding cavity formed by transmembrane helices that can guide similar approaches for ZDHHC13 . When expressing recombinant ZDHHC13 in mammalian cells for functional studies, plasmids containing epitope tags such as FLAG or HA facilitate immunoprecipitation and detection in downstream applications . To study specific ZDHHC13 variants, site-directed mutagenesis can be employed to generate constructs with modifications at key residues, such as the phosphorylation site S208 that is targeted by AMPK . For activity assays, recombinant ZDHHC13 can be incubated with palmitoyl-CoA and candidate substrate proteins, followed by detection of palmitoylation using methods such as click chemistry with alkyne-palmitate analogs or the acyl-biotin exchange technique. When studying mutant variants of ZDHHC13, it is crucial to verify proper protein expression, localization, and folding before attributing any observed effects to changes in enzymatic activity rather than protein stability or localization issues.

What genetic models are available for studying ZDHHC13 function in vivo?

Several genetic models have been developed for investigating ZDHHC13 function in vivo, providing valuable insights into its physiological roles. The "luc" mouse model, carrying a spontaneous recessive mutation in Zdhhc13, has been extensively characterized and exhibits multiple phenotypes including amyloidosis, alopecia, osteoporosis, behavioral abnormalities, and metabolic disturbances . This model has proven particularly useful for studying the consequences of ZDHHC13 deficiency on brain function, with detailed behavioral assessments revealing increased sensorimotor gating, anxiety, hypoactivity, and decreased motor coordination at 3 months of age . Another model, the Zdhhc13 (Hip14l) knockout mice generated on an FVB/N genetic background, has been used to study the relationship between ZDHHC13 and Huntington's disease, highlighting the importance of genetic background in phenotype manifestation . For cell-based models, ZDHHC13 knockdown approaches have been successfully implemented in various cell lines including Hep1-6 hepatocytes to study mitochondrial function and metabolism . These cellular models have revealed impaired mitochondrial function following ZDHHC13 depletion, consistent with observations in tissues from Zdhhc13-deficient mice . Researchers have also developed in vitro models using neuronal progenitor striatal cells (NPC) to investigate ZDHHC13's role in neuronal function and palmitoylation of specific substrates such as Drp1 . When selecting an appropriate model for ZDHHC13 research, it is important to consider that phenotypes may vary depending on genetic background, age, sex, and specific tissues being examined, as demonstrated by the comparative studies between different mouse models carrying Zdhhc13 mutations .

What strategies can be used to identify novel ZDHHC13 substrates?

Identifying novel ZDHHC13 substrates requires sophisticated strategies that can differentiate specific ZDHHC13 targets from proteins palmitoylated by other members of the ZDHHC family. A groundbreaking approach involves engineering orthogonal enzyme-substrate pairs for selective exploration of a specific enzyme's selectivity . This strategy pairs a synthetic fatty acyl CoA that can be utilized selectively by a mutant ZDHHC enzyme but not by the wild-type enzyme, allowing researchers to identify substrates specific to a particular ZDHHC enzyme despite the shared use of palmitoyl CoA across the ZDHHC family . In contrast to traditional methods that survey the entire ZDHHC family through overexpression or knockdown strategies while monitoring changes in substrate palmitoylation, this approach enables the identification of novel palmitoylated proteins without perturbation of the cellular pool of ZDHHC enzymes . For comprehensive identification of potential ZDHHC13 substrates, researchers have implemented a site-specific quantitative approach integrating alkylating resin-assisted capture with mass spectrometry-based label-free quantification, comparing palmitoylated proteins in wild-type versus Zdhhc13-deficient tissues . This method has successfully identified 400 S-palmitoylation sites on 254 proteins that were down-regulated in Zdhhc13-deficient mice, representing potential ZDHHC13 substrates . To confirm direct ZDHHC13-substrate interactions, techniques such as co-immunoprecipitation coupled with in vitro palmitoylation assays provide robust validation, as demonstrated for the Zdhhc13-Drp1 interaction . Bioinformatic approaches can also aid in substrate identification by analyzing the structural features and sequence motifs of known ZDHHC13 substrates to predict additional targets, although experimental validation remains essential for confirming true substrates.

How is ZDHHC13 involved in neurodegenerative disorders?

ZDHHC13 has emerged as a significant player in neurodegenerative disorders, particularly Huntington's disease (HD). Deficiencies in Zdhhc13 have been linked to HD, which is characterized by progressive neuropathology and motor deficits . This connection is supported by evidence showing Zdhhc13-dependent S-palmitoylation of huntingtin (Htt), the protein whose mutation causes HD . Both Zdhhc17 and Zdhhc13 have been identified as Htt-interacting proteins with dual functions as palmitoyltransferases and as facilitators of Mg²⁺ transport . The behavioral phenotypes observed in Zdhhc13-deficient mice partially recapitulate features of HD, including motor dysfunction assessed through rotarod performance and gait analysis via footprint testing . At the cellular level, loss of Zdhhc13 in brain tissues results in altered mitochondrial dynamics due to reduced palmitoylation of Drp1, leading to abnormal mitochondrial morphology and distribution . These mitochondrial disturbances affect not only energy production but also neurotransmission and synaptic structure integrity, which may contribute to the neuropathology observed in HD and potentially other neurodegenerative conditions . The neurological impact of ZDHHC13 deficiency extends beyond motor function to include cognitive and behavioral domains, with Zdhhc13-deficient mice showing increased anxiety-related behaviors and altered sensorimotor gating . These findings suggest that ZDHHC13's role in maintaining normal brain function involves multiple pathways and processes, with implications for various neurological disorders. Research on ZDHHC13 in neurodegenerative contexts provides insights into the broader role of protein palmitoylation in maintaining neuronal health and function, potentially identifying new therapeutic targets for these challenging conditions.

What role does ZDHHC13 play in cancer, particularly melanoma?

ZDHHC13 plays a crucial role in cancer biology, particularly in melanoma, through its interaction with the melanocortin-1 receptor (MC1R). Recent research has revealed that inherited genetic variations in MC1R responsible for red hair color (RHC-variants) are associated with impaired DNA damage repair and increased melanoma risk . MC1R signaling, which is critical for melanoma prevention, is fundamentally dependent on palmitoylation primarily mediated by ZDHHC13 . A key regulatory mechanism involves AMPK, which phosphorylates ZDHHC13 at serine 208, enhancing the interaction between ZDHHC13 and MC1R-RHC variants . This phosphorylation-enhanced interaction leads to increased MC1R palmitoylation in red-headed individuals, strengthening MC1R downstream signaling pathways that protect against UV damage . Experimental evidence demonstrates that AMPK activation and the resulting enhancement of MC1R palmitoylation effectively repress UVB-induced transformation of human melanocytes, suggesting a protective mechanism against melanomagenesis . The elucidation of this pathway provides a mechanistic explanation for the higher melanoma risk in individuals with red hair and identifies potential intervention points for melanoma prevention. Beyond melanoma, the role of ZDHHC13 in other cancers is an emerging area of research, with evidence suggesting that dysregulated protein palmitoylation may contribute to various aspects of cancer biology including cell proliferation, migration, and resistance to apoptosis. The identification of ZDHHC13 substrates involved in these processes could reveal new therapeutic targets across multiple cancer types, making this palmitoyltransferase a significant focus for cancer research.

How does ZDHHC13 influence mitochondrial function in metabolic disorders?

ZDHHC13 exerts profound effects on mitochondrial function with significant implications for metabolic disorders. Studies in Zdhhc13-deficient mice have revealed abnormal liver function, lipid abnormalities, and hypermetabolism, indicating a critical role for this enzyme in metabolic regulation . At the molecular level, ZDHHC13 deficiency results in impaired mitochondrial function in hepatocytes, both in Zdhhc13-deficient mice and in Zdhhc13-knockdown Hep1-6 cells . Proteomic analysis of the liver S-palmitoylome in these mice identified lipid metabolism and mitochondrial dysfunction proteins as overrepresented among the downregulated palmitoylation sites, suggesting that ZDHHC13 preferentially targets proteins involved in these processes . Two specific ZDHHC13 substrates confirmed in these studies, MCAT (malonyl CoA-acyl carrier protein transacylase) and CTNND1 (catenin delta-1), are involved in mitochondrial function and may contribute to the observed metabolic phenotypes when their palmitoylation is reduced . In brain tissue, ZDHHC13 deficiency leads to altered mitochondrial dynamics through reduced palmitoylation of Drp1, a key regulator of mitochondrial fission . This results in disrupted fission-fusion processes, abnormal mitochondrial morphology and distribution, and metabolic shifts including increased glycolysis, glutaminolysis, and lactic acidosis . These findings collectively establish ZDHHC13 as an important regulator of mitochondrial activity across multiple tissues, with implications for various metabolic disorders including fatty liver disease, insulin resistance, and mitochondrial dysfunction syndromes. The identification of specific ZDHHC13 substrates in mitochondria provides potential therapeutic targets for addressing metabolic disorders characterized by mitochondrial dysfunction.

What therapeutic approaches target ZDHHC13 or its downstream pathways?

Therapeutic approaches targeting ZDHHC13 or its downstream pathways represent an emerging frontier in addressing various disorders associated with dysregulated protein palmitoylation. One promising strategy involves activating AMPK, which phosphorylates ZDHHC13 at S208, enhancing its interaction with substrates such as MC1R . This approach has shown potential in preventing melanoma by increasing MC1R palmitoylation and downstream signaling, which represses UVB-induced transformation of human melanocytes . AMPK activators like metformin, already approved for treating type 2 diabetes, could potentially be repurposed for melanoma prevention in high-risk individuals, particularly those with red hair color variants . Another therapeutic avenue involves the development of small molecules that directly modulate ZDHHC13 activity or its interaction with specific substrates. The recent advances in understanding the structure of ZDHHC enzymes, such as the high-resolution structure of human ZDHHC20 with 2-bromopalmitate revealing the fatty acyl-binding cavity, provide valuable templates for rational drug design targeting these enzymes . For disorders involving mitochondrial dysfunction due to ZDHHC13 deficiency, interventions that bypass or compensate for reduced palmitoylation of key mitochondrial proteins like Drp1 could help restore normal mitochondrial dynamics and function . Additionally, gene therapy approaches to restore or augment ZDHHC13 expression in specific tissues represent a potential treatment strategy for genetic disorders caused by ZDHHC13 mutations. The engineered orthogonal enzyme-substrate pairs developed for research purposes could potentially be adapted for therapeutic applications, allowing selective restoration of palmitoylation for specific critical substrates while minimizing off-target effects. As research on ZDHHC13 continues to reveal its diverse roles in physiological and pathological processes, new therapeutic targets and approaches will likely emerge for addressing the broad spectrum of disorders associated with dysregulated protein palmitoylation.

What are the main technical challenges in working with recombinant ZDHHC13?

Working with recombinant ZDHHC13 presents several significant technical challenges that researchers must address to obtain reliable experimental results. The primary challenge stems from ZDHHC13's nature as a multi-pass transmembrane protein, which complicates its expression, purification, and maintenance of native conformation and activity. Standard bacterial expression systems often struggle with proper folding and post-translational modifications of such complex membrane proteins, potentially resulting in non-functional recombinant products. While GST-ZDHHC13 has been successfully expressed in bacterial systems for specific applications such as in vitro kinase assays , these preparations may not fully recapitulate the enzyme's native activity. Mammalian expression systems offer better protein folding and post-translational modifications but present challenges in scaling up production. Another significant hurdle involves maintaining ZDHHC13's activity during purification processes, as detergents required to solubilize membrane proteins can disrupt the enzyme's structure and function. The development of specialized lipid nanodiscs or other membrane-mimetic systems may help preserve ZDHHC13's native environment and activity. Additionally, designing appropriate activity assays presents difficulties due to the enzyme's two-step mechanism involving autoacylation followed by substrate transpalmitoylation . Distinguishing between these steps and accurately measuring the palmitoylation of specific substrates requires sensitive detection methods. The relatively low abundance of ZDHHC13 in native tissues further complicates biochemical and structural studies, necessitating overexpression systems that may not perfectly recapitulate physiological conditions. Finally, the overlapping substrate specificity among the 23 ZDHHC family members creates challenges in definitively assigning specific substrates to ZDHHC13, requiring carefully designed control experiments and validation approaches.

How can researchers distinguish between direct and indirect effects of ZDHHC13 manipulation?

Distinguishing between direct and indirect effects of ZDHHC13 manipulation represents a fundamental challenge in the field, requiring sophisticated experimental designs and careful controls. To identify direct ZDHHC13 substrates with confidence, researchers have implemented complementary approaches that provide multiple lines of evidence. In vitro palmitoylation assays using purified recombinant ZDHHC13 and candidate substrate proteins offer the most direct evidence of enzyme-substrate relationships, as demonstrated for specific substrates like Drp1 . Direct protein-protein interactions between ZDHHC13 and its substrates can be confirmed through co-immunoprecipitation experiments performed both in vitro with purified components and in vivo from relevant tissues or cell lines . The innovative orthogonal enzyme-substrate design strategy provides another powerful approach for identifying direct ZDHHC13 substrates by engineering mutant ZDHHC13 variants that selectively utilize synthetic fatty acyl CoA analogs . To distinguish primary (direct) from secondary (indirect) effects of ZDHHC13 deficiency on cellular phenotypes, acute manipulation through inducible knockdown or knockout systems offers advantages over constitutive models where compensatory mechanisms may develop over time. Temporal analysis following ZDHHC13 manipulation can help separate immediate direct effects from delayed indirect consequences. Rescue experiments represent another critical approach, where reintroduction of wild-type ZDHHC13 should reverse direct effects, while enzymatically inactive ZDHHC13 mutants (such as those with mutations in the DHHC catalytic domain) should not. When analyzing global palmitoylome changes in ZDHHC13-deficient models, normalization against protein expression levels through techniques like TMT10-plex labeling of the membrane proteome is essential to distinguish reduced palmitoylation from reduced protein expression . Finally, comparative studies across multiple ZDHHC family members can help identify substrate specificities and redundancies, clarifying which effects are uniquely attributable to ZDHHC13.

What are the emerging trends in ZDHHC13 research and future directions?

The field of ZDHHC13 research is rapidly evolving, with several emerging trends and promising future directions. One significant development is the application of structural biology approaches to understand the molecular mechanisms of ZDHHC13 function, building upon the high-resolution structure of the related ZDHHC20 with 2-bromopalmitate that revealed the fatty acyl-binding cavity formed by transmembrane helices . Advanced cryo-electron microscopy techniques may soon provide detailed structural insights into ZDHHC13, potentially revealing substrate recognition mechanisms and facilitating structure-based drug design. Another emerging trend involves the development of more sophisticated tools for studying protein palmitoylation dynamics, including genetically encoded biosensors that can monitor palmitoylation in real-time within living cells. These approaches could reveal the temporal and spatial regulation of ZDHHC13 activity under various physiological and pathological conditions. The integration of multi-omics approaches (proteomics, metabolomics, transcriptomics) to comprehensively analyze the consequences of ZDHHC13 manipulation represents another frontier, as exemplified by studies combining palmitoylome analysis with membrane proteome quantification . Research into the regulation of ZDHHC13 activity is gaining momentum, with the discovery that AMPK phosphorylates ZDHHC13 at S208, enhancing its interaction with specific substrates . This finding suggests that ZDHHC13 activity can be modulated by various cellular signaling pathways, opening new avenues for therapeutic intervention. The development of tissue-specific and inducible ZDHHC13 knockout models will help clarify its roles in different physiological contexts and developmental stages. Translation of basic ZDHHC13 research into therapeutic applications is an exciting frontier, with potential approaches including small molecule modulators of ZDHHC13 activity, AMPK activators to enhance ZDHHC13 function in specific contexts , and potentially gene therapy for ZDHHC13-deficient conditions. Finally, investigating the interplay between ZDHHC13 and other post-translational modifications may reveal complex regulatory networks controlling protein function and cellular processes.

How does ZDHHC13 interact with other post-translational modifications?

The interplay between ZDHHC13-mediated palmitoylation and other post-translational modifications (PTMs) represents a complex regulatory network that fine-tunes protein function across various cellular contexts. One well-documented interaction occurs between ZDHHC13 and phosphorylation pathways, exemplified by AMPK-mediated phosphorylation of ZDHHC13 at serine 208, which enhances its interaction with MC1R and subsequent palmitoylation of this receptor . This demonstrates how phosphorylation can directly modulate ZDHHC13 activity, creating a regulatory link between cellular energy sensing (via AMPK) and ZDHHC13-mediated palmitoylation. Beyond modifications of ZDHHC13 itself, the relationship between palmitoylation and other PTMs on substrate proteins creates additional regulatory complexity. For many proteins, palmitoylation can affect accessibility to other modification sites or change protein conformation to create or mask recognition motifs for other modifying enzymes. In the case of Drp1, a confirmed ZDHHC13 substrate critical for mitochondrial dynamics, palmitoylation interacts with other PTMs including phosphorylation, SUMOylation, and ubiquitination to control its activity, localization, and stability . These modifications can work cooperatively or antagonistically to fine-tune Drp1 function in response to various cellular signals. The temporal sequence of PTMs represents another important consideration, as prior modifications may be required for or may prevent subsequent ones, creating ordered modification cascades that precisely control protein function. The subcellular compartmentalization of different PTM machineries adds spatial regulation to this network, with ZDHHC13's localization to specific membrane compartments determining which substrates are accessible for palmitoylation. As analytical techniques continue to advance, enabling more comprehensive multi-modification analyses of proteins, a more complete picture of the PTM interactome involving ZDHHC13 will emerge. This knowledge will be crucial for understanding how cells integrate diverse signals to coordinate complex processes such as mitochondrial dynamics, neurotransmission, and response to cellular stress.

What are the optimal conditions for measuring ZDHHC13 enzymatic activity in vitro?

Establishing optimal conditions for measuring ZDHHC13 enzymatic activity in vitro requires careful consideration of multiple parameters to ensure reliable and reproducible results. The in vitro kinase assay protocol utilizing bacterially purified GST-ZDHHC13 provides a foundation for enzymatic activity measurements . This protocol involves incubating the purified enzyme with active recombinant kinases (such as AMPK) in a kinase buffer containing 25 mM MOPS (pH 7.5), 1 mM EGTA, 0.1 mM Na₃VO₄, and 15 mM MgCl₂, supplemented with 300 μM AMP and 100 μM ATP (or ATP mix with γ-³²P-ATP) for 60 minutes at 30°C . For measuring palmitoylation activity specifically, the buffer composition should be optimized to include appropriate concentrations of reducing agents (such as DTT or TCEP) to prevent non-specific oxidation of cysteine residues while maintaining the enzyme's activity. The palmitoyl-CoA concentration must be carefully titrated, typically in the 1-10 μM range, as higher concentrations may lead to micelle formation due to its detergent-like properties, potentially interfering with the assay. Temperature and pH optimization is essential, with most studies indicating optimal activity around pH 7.0-7.5 and temperatures between 25-37°C. When using radiolabeled palmitoyl-CoA (such as [³H]-palmitoyl-CoA) for detection, scintillation counting provides quantitative measurement of incorporation, while fluorescently labeled or clickable palmitate analogs offer non-radioactive alternatives. Detection sensitivity can be enhanced using methods such as acyl-biotin exchange followed by Western blotting or mass spectrometry. For kinetic studies, time-course experiments with sampling at multiple time points allow for determination of initial velocity conditions essential for accurate enzyme kinetics. When comparing wild-type ZDHHC13 with mutant variants or assessing the effects of potential inhibitors, parallel reactions under identical conditions with appropriate controls are crucial for valid comparisons.

How should researchers analyze and interpret palmitoylome data in ZDHHC13 studies?

Analyzing and interpreting palmitoylome data in ZDHHC13 studies requires sophisticated bioinformatic approaches and careful experimental design to extract meaningful biological insights. Researchers should begin with rigorous quality control of mass spectrometry data, assessing metrics such as peptide identification rates, quantification precision, and technical reproducibility across replicates. For quantitative comparisons between wild-type and ZDHHC13-deficient samples, normalization strategies are critical, with TMT10-plex labeling of the membrane proteome providing an effective method to distinguish changes in palmitoylation from changes in protein expression . Statistical analysis should employ appropriate models for identifying significantly altered palmitoylation sites, with multiple testing correction to control false discovery rates. When analyzing the liver S-palmitoylome, researchers identified 2,190 S-palmitoylated peptides corresponding to 883 S-palmitoylated proteins, with approximately 400 (31%) S-palmitoylation sites on 254 proteins being down-regulated in Zdhhc13-deficient mice . These down-regulated sites represent potential ZDHHC13 substrates and should be prioritized for further validation. Pathway enrichment analysis revealed that lipid metabolism and mitochondrial dysfunction proteins were overrepresented among down-regulated palmitoylation sites, providing functional context for the observed phenotypes . Comparative analysis with known ZDHHC13 substrates can help validate the approach and identify consensus motifs or structural features that might predict ZDHHC13 substrates. Network analysis integrating palmitoylome data with protein-protein interaction databases can reveal functional clusters and potential secondary effects of ZDHHC13 deficiency. Validation of key findings through orthogonal techniques such as ABE assays, site-directed mutagenesis of palmitoylation sites, and functional studies is essential for confirming the biological significance of identified substrates. Finally, integration of palmitoylome data with other omics datasets (transcriptomics, proteomics, metabolomics) can provide a systems-level understanding of how ZDHHC13-mediated palmitoylation coordinates various cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.