Recombinant Human Palmitoyltransferase ZDHHC17 (ZDHHC17)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Human Palmitoyltransferase ZDHHC17

Recombinant Human Palmitoyltransferase ZDHHC17 (ZDHHC17) is a membrane-bound enzyme belonging to the zDHHC family of S-acyltransferases. It catalyzes the post-translational modification S-palmitoylation, transferring palmitoyl groups from palmitoyl-CoA to cysteine residues in target proteins. This modification regulates protein stability, localization, and interactions. ZDHHC17 is encoded by the ZDHHC17 gene (also known as HIP14 or HIP3) and is highly expressed in neurons, particularly at the Golgi apparatus .

Role in Huntington’s Disease (HD)

ZDHHC17 interacts with mutant huntingtin (HTT) and regulates its S-acylation at Cys214. Pathogenic HTT disrupts this interaction, impairing ZDHHC17 activity and promoting neurodegeneration.

  • Mechanism: HTT enhances ZDHHC17 autoacylation, stabilizing its active form. Loss of HTT reduces ZDHHC17 activity, exacerbating inclusion formation in HD models .

  • Phenotype: ZDHHC17-knockout mice exhibit HD-like striatal neuron loss, mimicking HTT dysfunction .

NLRP3 Inflammasome Regulation

ZDHHC17 palmitoylates NLRP3 at Cys419, enabling NEK7 binding and inflammasome activation:

  • Palmitoylation site: C419 in the NACHT domain .

  • Functional impact: ZDHHC17 knockdown reduces NLRP3 palmitoylation and inflammasome activity in macrophages .

TGF-β/Smad Signaling Modulation

ZDHHC17 palmitoylates Smad7 at Cys415/417, enhancing its cytoplasmic localization and inhibition of TGF-β signaling:

  • Effect: Smad7 palmitoylation suppresses CAGA-luciferase reporter activity by 60–80% .

  • Mutant analysis: C415/417A Smad7 fails to inhibit TGF-β signaling .

MAPK Pathway Activation in Glioblastoma (GBM)

ZDHHC17 forms a complex with MAP2K4 (JNK/p38 kinase) at the Golgi, promoting GBM progression:

  • Mechanism: Recruitment of JNK/p38 to MAP2K4 enhances phosphorylation and glioma stem cell self-renewal .

  • Inhibition: Genistein disrupts ZDHHC17-MAP2K4 interaction, reducing tumor growth in vivo .

SubstratePalmitoylation SiteFunctional EffectSource
HTTCys214Enhanced stability; reduced inclusion
NLRP3Cys419Inflammasome activation via NEK7
Smad7Cys415/417TGF-β signaling suppression
SNAP25Cys residuesSynaptic vesicle fusion regulation

Production Systems

ZDHHC17 is recombinantly expressed in:

  • HEK293 cells: For functional studies (e.g., palmitoylation assays) .

  • E. coli: For structural studies, though membrane localization may require lipoparticles .

Assay Development

High-throughput screens (HTS) using TR-FRET detect ZDHHC17 autoacylation:

  • Inhibitors: Tetrazole derivatives (TTZ-1/2) show 35–40% inhibition of ZDHHC17-mediated SNAP25 palmitoylation .

InhibitorIC50 (ZDHHC17)EffectSource
TTZ-1Not reportedReduces SNAP25 palmitoylation by ~35%
TTZ-2Not reportedSimilar inhibition; affects enzyme levels

Clinical and Therapeutic Implications

  • Neurodegeneration: ZDHHC17 dysregulation links to HD and neuroinflammation via NLRP3 .

  • Cancer: Overexpression in GBM correlates with poor prognosis, suggesting ZDHHC17 as a therapeutic target .

  • Immunology: Modulation of ZDHHC17 may control inflammatory responses by targeting NLRP3 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ZDHHC17; HIP14; HIP3; HYPH; KIAA0946; HSPC294; Palmitoyltransferase ZDHHC17; Acyltransferase ZDHHC17; DHHC domain-containing cysteine-rich protein 17; DHHC17; Huntingtin yeast partner H; Huntingtin-interacting protein 14; HIP-14; Huntingtin-interacting protein 3; HIP-3; Huntingtin-interacting protein H; Putative MAPK-activating protein PM11; Putative NF-kappa-B-activating protein 205; Zinc finger DHHC domain-containing protein 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC17
Target Protein Sequence
MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV ISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR YFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF HFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Uniprot No.

Target Background

Function
Palmitoyltransferase ZDHHC17 is an enzyme responsible for catalyzing the addition of palmitate to various protein substrates, playing a vital role in numerous cellular processes. This enzyme demonstrates a broad fatty acid specificity and can transfer myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA to target proteins, in addition to palmitate. Notably, ZDHHC17 exhibits specific palmitoyltransferase activity toward a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1, and HTT. It also palmitoylates neuronal proteins GPM6A, SPRED1, and SPRED3. Furthermore, ZDHHC17 might contribute to axonogenesis through the regulation of NTRK1 and the downstream ERK1/ERK2 signaling cascade. The enzyme could be involved in the sorting or targeting of crucial proteins engaged in the initiation events of endocytosis at the plasma membrane. ZDHHC17 may also participate in Mg(2+) transport. Additionally, it can palmitoylate DNAJC5, influencing its localization to the Golgi membrane.
Gene References Into Functions
  1. Research has unveiled the structural basis for the interaction between DHHC17 and SNAP25b, a canonical substrate. These findings highlight the role of specific residues in substrate binding and palmitate transfer. Notably, the same residues are implicated in the binding of Huntingtin, another significant substrate of DHHC17. PMID: 28757145
  2. The abundant presence of zDABM sequences within the human proteome suggests that zDHHC17 could act as a central hub regulating diverse cellular processes. PMID: 28882895
  3. CPj0783 might disrupt normal vesicle-mediated transport by interacting with HIP14. PMID: 27611675
  4. Data indicate that deleting amino acids 1-427 from the huntingtin protein (HTT) disrupts its interaction with palmitoyl acyltransferases HIP14 and HIP14L, which are associated with Huntington's disease. This disruption likely contributes to the mislocalization of HTT and other HIP14/HIP14L substrates. PMID: 25849918
  5. Research has shown that deleting the first 427 amino acids of the huntingtin protein (HTT) eliminates its interaction with palmitoyl acyltransferases HIP14 and HIP14L. PMID: 24651384
  6. HIP14 shares a substantial number of interactors with HTT, leading to impaired palmitoylation of target proteins. This could be a critical mechanism involved in the pathogenesis of Huntington's disease. PMID: 24705354
  7. DHHC17 is a ClipR-59 palmitoyltransferase that modulates ClipR-59 binding to the plasma membrane. PMID: 24001771
  8. Low levels of human HIP14 are sufficient to rescue neuropathological, behavioral, and enzymatic defects caused by the loss of murine HIP14 in Hip14-/- mice. PMID: 22649491
  9. Immunohistochemical analysis of pancreatic sections reveals that HIP14 is primarily expressed in insulin-positive cells within the islets of Langerhans. PMID: 21705657
  10. Novel peptides have been developed that target the jun N-terminus kinase (JNK)-interacting motif on zD17 to selectively inhibit the enhancement of the zD17-Jun N terminus kinase (JNK) interaction and the activation of JNK isoforms 2 and 3. PMID: 21849558
  11. A subset of DHHCs regulates STREX palmitoylation and function; DHHC17 may preferentially target cysteine-rich domains. PMID: 20507996
  12. Coexpression of an independent palmitoyl acyltransferase (HIP14) with the GODZ-DHHS mutant also rescued Ca(2+) transport. PMID: 19955568
  13. ZDHHC17 has the capacity to induce colony formation in cell culture, anchorage-independent growth, and tumor formation in mice. PMID: 15489887
  14. The genes encoding huntingtin interacting proteins, HIP14 and HIP14L, code for Mg2+ transport proteins that are regulated by their intrinsic palmitoyl acyltransferases, exhibiting characteristics of "chanzymes." PMID: 18794299
  15. The ankyrin repeat domain of Huntingtin interacting protein 14 contains a surface aromatic cage, a potential site for methyl-lysine binding. PMID: 19434754
  16. HIP14 functions as a protein palmitoyl acyltransferase. PMID: 15489887

Show More

Hide All

Database Links

HGNC: 18412

OMIM: 607799

KEGG: hsa:23390

STRING: 9606.ENSP00000403397

UniGene: Hs.4014

Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all brain regions. Expression is highest in the cortex, cerebellum, occipital lobe and caudate and lowest in the spinal cord. Expression is also seen in testis, pancreas, heart and kidney.

Q&A

What is the structural organization of ZDHHC17 and how does it relate to its function?

ZDHHC17 belongs to the DHHC family of S-acyltransferases, characterized by a conserved Asp-His-His-Cys (DHHC) motif essential for catalytic activity. The protein contains two main structural domains:

  • An N-terminal ankyrin repeat domain (ANK17) that mediates substrate recognition and binding

  • A catalytic DHHC domain containing the active site for the palmitoylation reaction

Crystal structure studies have revealed that the ankyrin repeat domain of ZDHHC17 forms specific interactions with substrates such as Snap25b . This domain is critical for substrate selectivity, as demonstrated by its interaction with the C-terminal linker-MH2 domains of Smad7 . Importantly, ZDHHC17 exhibits strict cytoplasmic localization, which is consistent with its role in mobilizing certain substrates like Smad7 to the cytoplasm .

The catalytic mechanism involves a two-step process: first, ZDHHC17 undergoes autopalmitoylation at the catalytic cysteine within the DHHC motif, and subsequently transfers the palmitoyl group to cysteine residues on target proteins . Mutations that disrupt this catalytic activity, such as the C467A or C467S substitutions, render the enzyme unable to effectively palmitoylate its substrates .

How does ZDHHC17 recognize and select its substrate proteins?

ZDHHC17 demonstrates selective substrate recognition primarily through its N-terminal ankyrin repeat domain. Several key findings illuminate this process:

  • ZDHHC17 interacts with Smad7 predominantly through its N-terminal ankyrin repeats, binding to the C-terminal linker-MH2 domains of Smad7

  • Unlike some other DHHC enzymes with broad substrate specificity, ZDHHC17 shows higher selectivity, as evidenced by its ability to palmitoylate Smad7 but not other Smad proteins (Smad2, Smad3, Smad4, Smad6) or TGF-β receptors

  • Many ZDHHC17 substrates contain a zDHHC ankyrin-repeat binding motif (zDABM), though some substrates like Smad7 interact with ZDHHC17 through alternative binding interfaces

  • Interestingly, the interaction between ZDHHC17 and Smad7 was found to be independent of the W130 residue that is essential for binding to other substrates with classical zDABM motifs

This selective substrate recognition is critical for understanding the specific cellular functions regulated by ZDHHC17-mediated palmitoylation.

What are the most effective methods to detect and quantify protein palmitoylation mediated by ZDHHC17?

Several complementary approaches have proven effective for detecting and quantifying ZDHHC17-mediated palmitoylation:

Acyl Resin-Assisted Capture (Acyl-RAC) Assay:

  • Removes acyl groups from cysteine residues using hydroxylamine

  • Directly conjugates freed cysteines to thiol-reactive resin

  • Allows specific isolation and detection of S-acylated proteins

  • Successfully used to detect Smad7 palmitoylation in experimental settings

Metabolic Labeling with Click Chemistry:

  • Cells are labeled with alkynyl palmitic acid

  • Click chemistry reaction links modified proteins to detectable tags

  • Provides direct visualization of newly palmitoylated proteins

  • Demonstrated significantly increased palmitoylation of Smad7 when ZDHHC17 was overexpressed

Site-Specific Mutagenesis:

  • Systematic mutation of individual cysteine residues in target proteins

  • Combined with either Acyl-RAC or metabolic labeling

  • Identifies specific palmitoylation sites

  • Revealed four cysteine residues in Smad7 (Cys202, Cys225, Cys415, and Cys417) as palmitoylation acceptor sites

Critical experimental controls should include:

  • Treatment with palmitoylation inhibitor 2-bromopalmitate (2-BP)

  • Comparison with catalytically inactive ZDHHC17 mutants (C467A/S)

  • Hydroxylamine-free controls in Acyl-RAC experiments

What approaches can be used to investigate the functional consequences of ZDHHC17-mediated palmitoylation?

To determine the functional impacts of ZDHHC17-mediated palmitoylation, researchers can employ several approaches:

Protein Stability Analysis:

  • Cycloheximide chase experiments to measure protein half-life

  • Comparison of wild-type proteins versus palmitoylation-deficient mutants

  • Has demonstrated that palmitoylation enhances Smad7 stability

Subcellular Localization Studies:

  • Immunofluorescence microscopy of wild-type versus palmitoylation-deficient mutants

  • Subcellular fractionation followed by western blotting

  • Revealed that ZDHHC17-mediated palmitoylation promotes cytoplasmic localization of Smad7

Functional Reporter Assays:

  • Pathway-specific reporter systems (e.g., CAGA-luciferase for TGF-β signaling)

  • Comparison of wild-type versus palmitoylation-deficient proteins

  • Showed that Smad7 C415/417A mutant had significantly reduced ability to inhibit TGF-β-dependent promoter activity

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation experiments

  • Proximity ligation assays

  • Pull-down assays with recombinant proteins

  • Demonstrated that ZDHHC17 interacts with Smad7 preferentially through its C-terminal domain

How does ZDHHC17-mediated palmitoylation regulate TGF-β signaling?

ZDHHC17 plays a crucial role in modulating TGF-β signaling through palmitoylation of the inhibitory protein Smad7:

Mechanism of Regulation:

  • ZDHHC17 palmitoylates Smad7 at four cysteine residues: Cys202, Cys225, Cys415, and Cys417

  • Palmitoylation at C415 and C417 in the C-terminal MH2 domain is particularly important for Smad7's function

  • S-palmitoylation by ZDHHC17 promotes:

    • Translocation of Smad7 from the nucleus to the cytoplasm

    • Enhanced stability of the Smad7 protein

    • Increased inhibitory effect on TGF-β-induced Smad transcriptional responses

Experimental Evidence:

  • CAGA-luciferase reporter assays showed that wild-type ZDHHC17 overexpression suppressed TGF-β-induced promoter activity

  • The ZDHHC17ΔNAnk construct (with reduced ability to palmitoylate Smad7) showed less inhibitory effect on TGF-β signaling

  • A Smad7 C415/417A mutant that cannot be palmitoylated at these sites showed significantly reduced ability to inhibit TGF-β-dependent promoter activity

This regulatory mechanism represents a novel post-translational modification that enhances the inhibitory effect of Smad7 against TGF-β signaling, adding another layer of control to this important signaling pathway .

What other substrates of ZDHHC17 have been identified and what are their functions?

ZDHHC17 has been found to palmitoylate several key substrates besides Smad7:

Neuronal Substrates:

  • Snap25b: A SNARE protein essential for synaptic vesicle fusion and neurotransmitter release

  • Huntingtin (HTT): The protein associated with Huntington's disease; ZDHHC17 palmitoylation affects its subcellular localization and potentially its neurotoxicity

Experimental Characterization:

  • Crystal structure analysis has revealed specific interactions between the ankyrin repeat domain of ZDHHC17 (ANK17) and Snap25b

  • Structure-guided mutagenesis identified key residues in ZDHHC17 that are critically important for interaction with both Snap25b and Huntingtin

  • Unlike some broadly specific DHHC enzymes, ZDHHC17 shows substrate selectivity, as evidenced by its inability to palmitoylate other Smad proteins (Smad2, Smad3, Smad4, Smad6) or TGF-β receptors in the same pathway as Smad7

Understanding the diverse substrate profile of ZDHHC17 is essential for comprehending its wide-ranging roles in cellular processes, particularly in neuronal function and cell signaling pathways.

What is known about the structural basis of ZDHHC17-substrate recognition?

Recent structural and biochemical studies have provided significant insights into ZDHHC17-substrate recognition:

Key Structural Features:

Substrate Binding Determinants:

  • Structure-guided mutagenesis has identified key residues in ZDHHC17 that are crucial for interaction with substrates

  • For Smad7, ZDHHC17 preferentially binds to the C-terminal part containing the linker and MH2 domains

  • Interestingly, the interaction between ZDHHC17 and Smad7 was found to be independent of W130, an essential residue for the binding of ZDHHC17 to other substrates

  • This suggests that Smad7 does not contain a classical zDHHC ankyrin-repeat binding motif (zDABM)

These structural insights provide a foundation for understanding the molecular basis of ZDHHC17 substrate selectivity and may guide the development of specific modulators of ZDHHC17-substrate interactions.

How does ZDHHC17 compare to other DHHC family members in terms of substrate specificity?

ZDHHC17 exhibits distinctive characteristics compared to other DHHC family members:

Specificity Profile:

  • ZDHHC17 is considered a high-selectivity/low-activity enzyme, requiring specific recognition of substrate proteins for successful S-acylation

  • In contrast, enzymes like ZDHHC3 and ZDHHC7 are low-selectivity/high-activity isoforms that are active against numerous proteins without apparent specific recognition features

Substrate Recognition:

  • ZDHHC17 primarily recognizes substrates through its N-terminal ankyrin repeat domain

  • While many DHHC enzymes can palmitoylate multiple substrates, ZDHHC17 shows selectivity even within the same signaling pathway (e.g., palmitoylating Smad7 but not other Smad proteins)

Structural Relationships:

  • ZDHHC17 shares structural similarities with ZDHHC13, another high-selectivity/low-activity enzyme

  • ZDHHC17 is the human homolog of palmitoyl acyl-transferase dHIP14 which catalyzes Dad (Drosophila homolog of inhibitory Smad) palmitoylation in Drosophila

This distinctive substrate specificity profile makes ZDHHC17 particularly interesting for targeting specific cellular pathways without broadly affecting protein palmitoylation throughout the cell.

What are common challenges in expressing and purifying recombinant ZDHHC17 for in vitro studies?

Expressing and purifying functional recombinant ZDHHC17 presents several challenges:

Expression System Considerations:

  • Mammalian expression systems (particularly HEK293T cells) have been successfully used for overexpression studies

  • The transmembrane nature of ZDHHC17 complicates bacterial expression systems

  • When designing expression constructs, N-terminal tags (FLAG, HA) are preferable, as C-terminal tags might interfere with the catalytic domain

Purification Challenges:

  • Maintaining the native conformation of the transmembrane domains during purification

  • Preserving catalytic activity throughout the purification process

  • Preventing protein aggregation due to hydrophobic regions

Recommended Solutions:

  • Use mild detergents during purification to solubilize the membrane-associated enzyme

  • Include glycerol in buffers to enhance protein stability

  • Validate purified protein function through autopalmitoylation assays

  • For activity studies, consider reconstitution in liposomes or detergent micelles containing palmitoyl-CoA

  • Monitor protein quality using size exclusion chromatography to ensure homogeneity

How can researchers differentiate between ZDHHC17-specific palmitoylation and modification by other DHHC enzymes?

Distinguishing ZDHHC17-specific palmitoylation from that catalyzed by other DHHC enzymes requires strategic experimental approaches:

Knockout/Knockdown Studies:

  • Generate ZDHHC17-specific knockout or knockdown models

  • Perform rescue experiments with wild-type versus catalytically inactive ZDHHC17 (C467A/S mutants)

  • Compare palmitoylation patterns across multiple DHHC-family knockouts

Substrate Specificity Analysis:

  • Examine palmitoylation of candidate substrates across all 23 DHHC family members

  • For Smad7, studies have shown specificity for ZDHHC17-mediated palmitoylation compared to other proteins in the TGF-β pathway

Structural Analysis:

  • Leverage the unique structural features of ZDHHC17, particularly its ankyrin repeat domain

  • Investigate binding patterns that distinguish ZDHHC17 from other DHHC enzymes

  • As shown with Smad7, substrate recognition by ZDHHC17 can involve specific domains and isn't always dependent on classical binding motifs

Quantitative Approaches:

  • Compare palmitoylation efficiency across different DHHC enzymes

  • Assess temporal dynamics of palmitoylation in synchronized cells

  • Evaluate subcellular localization patterns of both enzyme and substrate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.