Recombinant Human Palmitoyltransferase ZDHHC18 (ZDHHC18)

Shipped with Ice Packs
In Stock

Description

Overview of ZDHHC18

ZDHHC18 is a palmitoyltransferase enzyme primarily localized to the Golgi apparatus and endoplasmic reticulum . It transfers palmitoyl groups from palmitoyl-CoA to cysteine residues on target proteins, modulating their membrane association, activity, and subcellular localization. Recombinant ZDHHC18 is widely used in biochemical assays to study its enzymatic activity and substrate specificity.

PropertyDescription
Gene ID1309334 (Rat), 6480464 (Human)
Subcellular LocalizationGolgi apparatus, endoplasmic reticulum
Key SubstratescGAS, HRAS
Catalytic MotifDHHC (Asp-His-His-Cys) domain
FunctionNegative regulation of cGAS-mediated immunity; promotion of renal fibrosis

Regulation of cGAS-Mediated Innate Immunity

ZDHHC18 palmitoylates cGAS at Cysteine 474 (C474), a modification that:

  1. Inhibits DNA Binding: Palmitoylation reduces cGAS’s interaction with double-stranded DNA (dsDNA), preventing the formation of the 2:2 cGAS-DNA complex required for activation .

  2. Impedes Dimerization: Palmitoylation disrupts cGAS dimerization, a critical step for enzymatic activity and cyclic GMP-AMP (cGAMP) production .

  3. Suppresses cGAS Signaling: Overexpression of ZDHHC18 reduces TBK1/IRF3 phosphorylation and IFN-β promoter activity, attenuating type I interferon responses .

Experimental Evidence:

  • ZDHHC18 Knockdown: Increased cGAS activity and resistance to DNA virus infections in mice .

  • C474S Mutation: Abolished palmitoylation, enhancing cGAS dimerization and immune signaling .

Role in Renal Fibrosis

ZDHHC18 palmitoylates HRAS, facilitating its membrane localization and activation of MEK/ERK signaling. This process promotes:

  1. Partial Epithelial-Mesenchymal Transition (EMT): Upregulation of Snai1 and Has2 via RREB1-mediated transcriptional activation .

  2. Fibrotic Cytokine Production: Increased TGF-β1-driven profibrotic responses in renal tubular epithelial cells .

Experimental Evidence:

  • Tubule-Specific ZDHHC18 KO: Reduced fibrosis in unilateral ureteral obstruction (UUO) and folic acid-induced models .

  • ZDHHC18 Overexpression: Exacerbated renal fibrosis by enhancing HRAS palmitoylation .

Substrate Specificity

SubstratePalmitoylation SiteFunctional OutcomeReference
cGASC474Inhibited dsDNA binding; reduced cGAS dimerization
HRASCysteine residuesEnhanced membrane localization; activated MEK/ERK

Biological Implications

Disease ContextZDHHC18 RoleExperimental ModelOutcomeReference
DNA Virus InfectionsNegative regulation of cGASZdhhc18-deficient miceIncreased antiviral resistance
Renal FibrosisPromotion of EMT and fibrosisUUO and FA-induced modelsAttenuated fibrosis (ZDHHC18 KO)
Autoimmune DiseasesSuppression of cGAS hyperactivationHuman/mouse cell linesReduced type I IFN responses

Therapeutic Potential

  1. Antiviral and Anti-Inflammatory Targets: Inhibiting ZDHHC18 could enhance cGAS-mediated immunity against DNA viruses while mitigating autoimmune disorders linked to cGAS hyperactivation (e.g., lupus) .

  2. Fibrosis Treatment: Targeting ZDHHC18 may reduce renal or hepatic fibrosis by blocking HRAS palmitoylation and downstream fibrotic pathways .

Challenges and Considerations

  • Dual Roles: ZDHHC18’s opposing effects in immunity and fibrosis necessitate context-specific therapeutic strategies.

  • Off-Target Effects: Palmitoylation is a reversible and dynamic process; pan-ZDHHC inhibitors may disrupt other critical pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
ZDHHC18; Palmitoyltransferase ZDHHC18; DHHC domain-containing cysteine-rich protein 18; DHHC-18; Zinc finger DHHC domain-containing protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC18
Target Protein Sequence
MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSG SLGRRPRRKWEVFPGRNRFYCGGRLMLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKL TLAIPIIAAILFFFVMSCLLQTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTR EVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAF ILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVLELVICFFSIWSILGLSGFHT YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQS DTVLPSPIRSDEPACRAKPDASMVGGHP
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It palmitoylates HRAS and LCK. It may also have palmitoyltransferase activity towards the beta-2 adrenergic receptor/ADRB2, thereby regulating G protein-coupled receptor signaling.
Database Links

HGNC: 20712

KEGG: hsa:84243

STRING: 9606.ENSP00000363257

UniGene: Hs.523710

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the primary function of ZDHHC18 in cellular processes?

ZDHHC18 functions as a palmitoyltransferase that catalyzes the post-translational modification of proteins through palmitoylation. This modification involves the addition of a palmitate group to specific cysteine residues of target proteins. In cellular processes, ZDHHC18 primarily regulates protein localization, stability, and function through this palmitoylation mechanism.

The enzyme has been demonstrated to play a critical role in regulating innate immunity by modifying the cyclic guanosine monophosphate-adenosine monophosphate synthase (cGAS) at cysteine 474 (C474), which inhibits cGAS activity and subsequent immune responses . Additionally, ZDHHC18 contributes to renal fibrosis development by catalyzing the palmitoylation of HRAS, facilitating its translocation to the plasma membrane and activating downstream signaling pathways .

How is ZDHHC18 expression regulated in normal tissues versus disease states?

In chronic kidney disease (CKD), ZDHHC18 expression is markedly upregulated in fibrotic kidneys. Immunohistochemistry studies have shown minimal ZDHHC18 expression in non-fibrotic kidney tissues but intense staining in fibrotic kidneys, predominantly in dilated proximal tubules that exhibit flat, thin epithelium without brush borders . The expression levels of ZDHHC18 positively correlate with several clinical parameters of kidney dysfunction:

ParameterCorrelation with ZDHHC18Significance
Tubular injury scorePositive correlationp < 0.05
Serum creatinine levelsPositive correlationp < 0.05
Blood urea nitrogen levelsPositive correlationp < 0.05
Estimated glomerular filtration rateNegative correlationp < 0.05

These correlations suggest that ZDHHC18 expression increases as kidney function deteriorates, highlighting its potential role in disease progression .

What are the known substrates of ZDHHC18 and their palmitoylation sites?

ZDHHC18 has been identified to palmitoylate several key proteins involved in cellular signaling pathways. The most well-characterized substrates include:

  • cGAS (cyclic GMP-AMP synthase): Palmitoylated at cysteine 474 (C474), which restricts its enzymatic activity in the presence of double-stranded DNA and inhibits innate immune responses .

  • HRAS: Palmitoylated by ZDHHC18, which is crucial for HRAS translocation to the plasma membrane and subsequent activation of downstream signaling cascades involved in renal fibrosis .

The specificity of ZDHHC18 for these substrates appears to be determined by protein-protein interactions, as demonstrated by coimmunoprecipitation experiments showing physical interaction between ZDHHC18 and cGAS in transfected HEK293T cells .

What cellular compartments does ZDHHC18 primarily localize to?

ZDHHC18 is a membrane-associated protein with a distinct subcellular localization pattern. Confocal imaging studies have revealed that transiently overexpressed ZDHHC18 primarily localizes to the Golgi apparatus with a Pearson's correlation coefficient of approximately 0.6, while showing minimal colocalization with the endoplasmic reticulum (correlation coefficient less than 0.05) .

Interestingly, the subcellular localization of ZDHHC18 appears to be expression-level dependent. While transiently overexpressed ZDHHC18 predominantly localizes to the Golgi apparatus, stably overexpressed ZDHHC18 shows overlap with the endoplasmic reticulum rather than the Golgi apparatus, suggesting that expression levels can alter its localization pattern .

The middle region of ZDHHC18, which contains four predicted transmembrane domains, is essential for its Golgi localization. Deletion of this region (ΔM truncation) reduces the Pearson's correlation coefficient with the Golgi apparatus to less than 0.2, confirming that the membrane-associated middle region determines ZDHHC18's subcellular localization .

How does ZDHHC18-mediated palmitoylation of cGAS regulate innate immune responses?

ZDHHC18-mediated palmitoylation of cGAS represents a sophisticated negative regulatory mechanism in innate immunity. This process involves several molecular steps that ultimately attenuate cGAS-mediated immune signaling:

  • Palmitoylation site identification: ZDHHC18 catalyzes the palmitoylation of cGAS at cysteine 474 (C474), with this modification significantly increasing in the presence of double-stranded DNA stimuli .

  • Inhibition of DNA binding: Palmitoylation of cGAS at C474 reduces its interaction with double-stranded DNA, as demonstrated by ISD (IFN-stimulatory DNA) pull-down assays. When ZDHHC18 is overexpressed, the formation of the cGAS-DNA complex is progressively abrogated in a dose-dependent manner .

  • Disruption of cGAS dimerization: Following impaired DNA binding, ZDHHC18-mediated palmitoylation inhibits cGAS dimerization, a critical step for its activation. This has been confirmed through co-immunoprecipitation experiments where ZDHHC18 expression markedly reduced the interaction between differently tagged cGAS molecules .

  • Suppression of downstream signaling: Consequently, ZDHHC18 overexpression significantly reduces cGAS/STING-mediated interferon-β (IFN-β) promoter activation in a dose-dependent manner and decreases TBK1 phosphorylation levels. Moreover, ZDHHC18 expression reduces cGAMP production, as measured by LC-MS/MS analysis .

The functional significance of this regulatory mechanism is highlighted by experiments showing that Zdhhc18-deficient mice exhibit enhanced resistance to DNA virus infections, consistent with increased cGAS-mediated immune responses in the absence of this negative regulator .

What approaches can be used to specifically inhibit or enhance ZDHHC18 activity in experimental models?

Researchers have employed several strategic approaches to modulate ZDHHC18 activity in experimental models, each with specific advantages for different research questions:

Genetic Approaches:

  • Gene knockout models: Tubule-specific deletion of ZDHHC18 using Cre-lox recombination systems has been successful in examining its role in renal fibrosis. This approach demonstrated that ZDHHC18 deletion attenuates tubular epithelial cells' partial epithelial-mesenchymal transition (EMT) and reduces production of profibrotic cytokines .

  • RNA interference: Both short hairpin RNA (shRNA) and small interfering RNA (siRNA) have been effectively used to knock down ZDHHC18 expression. In THP-1 cells, siRNA cocktails targeting non-overlapping regions of ZDHHC18 efficiently reduced endogenous expression and enhanced innate immune responses to ISD stimulation .

  • Site-directed mutagenesis: Creating catalytically inactive mutants, such as the cysteine-to-serine substitution in the DHHC motif of ZDHHC18 (ZDHHC18(CS)), has proven valuable for dissecting the enzyme's functional mechanisms. This mutant rescues the inhibitory effects on cGAS-DNA complex formation, confirming the importance of acyltransferase activity .

Pharmacological Approaches:

  • Palmitoylation modulators: 2-bromopalmitate (2-BP), a general inhibitor of palmitoylation, has been used to block ZDHHC18-mediated palmitoylation, enhancing cGAS dimerization and activation. Conversely, supplementation with palmitic acid promotes palmitoylation and reduces cGAS activity .

Expression Modulation:

  • Overexpression systems: Transient or stable overexpression of wild-type or mutant ZDHHC18 has been instrumental in determining its role in various cellular processes. For instance, overexpression of ZDHHC18 in HEK293T cells reduces cGAMP production by cGAS, while the catalytically inactive ZDHHC18(CS) rescues this effect .

The choice of approach depends on the specific research question, with combinatorial approaches often providing the most comprehensive understanding of ZDHHC18 function.

How does ZDHHC18 contribute to fibrosis development through HRAS palmitoylation?

ZDHHC18 plays a pivotal role in renal fibrosis development through a complex mechanism centered on HRAS palmitoylation and subsequent activation of pro-fibrotic signaling cascades:

  • Upregulation in fibrotic conditions: ZDHHC18 expression is significantly elevated in experimental models of renal fibrosis, including unilateral ureteral obstruction (UUO) and folic acid-induced (FA-induced) fibrosis, as well as in fibrotic kidneys from patients with chronic kidney disease (CKD) .

  • HRAS palmitoylation: ZDHHC18 catalyzes the palmitoylation of HRAS, which is essential for its translocation to the plasma membrane. This post-translational modification determines the subcellular localization and activity state of HRAS .

  • Activation of downstream signaling: Once properly localized, palmitoylated HRAS activates the MEK/ERK signaling pathway through phosphorylation events. This activation is critical for the progression of fibrosis .

  • RREB1 activation: The activated MEK/ERK pathway subsequently enhances Ras-responsive element-binding protein 1 (RREB1) activity, which functions as a transcriptional regulator .

  • Enhanced SMAD binding: RREB1 activation promotes SMAD binding to the cis-regulatory regions of pro-fibrotic genes, particularly Snai1 and Has2, driving their expression and promoting partial epithelial-mesenchymal transition (EMT) in tubular epithelial cells .

  • Partial EMT and fibrosis progression: This partial EMT phenotype leads to increased production of profibrotic cytokines and extracellular matrix components, ultimately resulting in progressive tubulointerstitial fibrosis .

The causal relationship between ZDHHC18 and fibrosis has been confirmed through gain- and loss-of-function studies. Tubule-specific deletion of ZDHHC18 attenuates fibrosis development, while ZDHHC18 overexpression exacerbates progressive renal fibrosis, establishing ZDHHC18 as a potential therapeutic target for combating kidney fibrosis .

What are the methodological challenges in assessing protein palmitoylation mediated by ZDHHC18?

Assessment of ZDHHC18-mediated protein palmitoylation presents several methodological challenges that researchers must navigate carefully:

  • Detecting palmitoylation events: The acyl-RAC (resin-assisted capture) assay has emerged as a primary method for detecting protein palmitoylation. This technique involves treating samples with hydroxylamine to cleave thioester bonds, followed by capture of newly exposed thiols using thiol-reactive resins. When applying this method to ZDHHC18 research, careful optimization is required to ensure specific detection of palmitoylation signals against background noise .

  • Distinguishing specific ZDHHC18 substrates: With 23 members in the DHHC-palmitoyl transferase family, attributing palmitoylation of a specific substrate to ZDHHC18 requires systematic approaches. Researchers have addressed this through:

    • Comparative expression analysis of all ZDHHC family members

    • shRNA-mediated knockdown of individual ZDHHC proteins

    • Co-overexpression experiments with ZDHHC18 and potential substrates

  • Verifying palmitoylation sites: Identifying the exact cysteine residue(s) modified by ZDHHC18 often requires site-directed mutagenesis to create cysteine-to-serine substitutions at potential palmitoylation sites. For cGAS, the C474S mutation abolished palmitoylation, confirming it as the primary modification site .

  • Quantifying palmitoylation levels: LC-MS/MS methods can be used to quantitatively assess palmitoylation, but require specialized equipment and expertise. For cGAMP production analysis, researchers have optimized LC-MS/MS techniques to measure ZDHHC18's impact on cGAS enzymatic activity .

  • Assessing functional consequences: Determining how ZDHHC18-mediated palmitoylation affects protein function often requires multiple complementary approaches:

    • DNA binding assays (e.g., ISD pull-down) to assess cGAS-DNA interactions

    • Co-immunoprecipitation experiments to examine protein-protein interactions

    • FRET (Förster resonance energy transfer) analysis to measure protein dimerization in real-time

    • Luciferase reporter assays to quantify downstream signaling activation

These methodological challenges highlight the need for multifaceted approaches when studying ZDHHC18-mediated palmitoylation, combining biochemical, cellular, and functional assays to build a comprehensive understanding of this post-translational modification.

How do disease-associated mutations or polymorphisms in ZDHHC18 affect its function?

While the search results do not specifically address disease-associated mutations or polymorphisms in ZDHHC18, we can discuss the functional consequences of experimentally-induced mutations that provide insight into potential disease mechanisms:

  • Catalytic domain mutations: The cysteine-to-serine substitution in the DHHC motif (ZDHHC18(CS)) creates a catalytically inactive enzyme. This mutation abolishes the palmitoylation activity of ZDHHC18, preventing it from modifying target proteins such as cGAS . In disease contexts, similar mutations could potentially lead to dysregulated innate immune responses due to enhanced cGAS activity or reduced fibrotic progression through impaired HRAS activation.

  • Structural domain alterations: Truncation studies have revealed that the middle region of ZDHHC18, containing four transmembrane domains, is essential for its localization to the Golgi apparatus. The ΔM truncation with deletion of this middle region shows altered subcellular localization . In disease scenarios, mutations affecting this region could disrupt proper ZDHHC18 localization and subsequently impair its functional interactions with substrate proteins.

  • Interaction domain changes: The non-membrane regions (N- and C-terminal portions) of ZDHHC18 are primarily responsible for its association with cGAS . Mutations in these regions could potentially alter substrate recognition and binding, affecting the specificity and efficiency of palmitoylation.

Given ZDHHC18's emerging roles in both innate immunity and fibrotic diseases, future research should prioritize examining:

  • Natural genetic variants of ZDHHC18 in immune disorders and fibrotic conditions

  • Correlation between ZDHHC18 polymorphisms and disease severity or progression

  • Functional consequences of patient-derived ZDHHC18 variants on its enzymatic activity and substrate specificity

Such studies would significantly enhance our understanding of how ZDHHC18 variations contribute to disease pathogenesis and potentially reveal new therapeutic opportunities.

What are the optimal expression systems for producing recombinant ZDHHC18 for biochemical studies?

The selection of an appropriate expression system for recombinant ZDHHC18 production is critical for successful biochemical studies. Based on the available research, several expression systems have been utilized with varying degrees of success:

  • Mammalian expression systems: HEK293T cells have been successfully used for ZDHHC18 expression in multiple studies. This system provides proper post-translational modifications and membrane insertion for this multi-transmembrane domain protein. For ZDHHC18 studies, researchers have employed:

    • Transient transfection with epitope-tagged constructs (HA, Flag) for interaction studies

    • Stable overexpression systems for localization studies and functional assays

  • Vector selection considerations: When designing expression constructs for ZDHHC18, researchers should consider:

    • Including appropriate epitope tags (HA, Flag, GFP) that don't interfere with enzymatic activity

    • Using inducible promoters to control expression levels, as ZDHHC18 localization can vary depending on expression level

    • Incorporating mutations at the DHHC motif (ZDHHC18(CS)) as negative controls for enzymatic activity

  • Purification strategies: As a membrane protein with multiple transmembrane domains, ZDHHC18 purification presents challenges requiring specialized approaches:

    • Detergent screening to identify optimal solubilization conditions

    • Tandem affinity purification tags to improve purity

    • Size exclusion chromatography to separate monomeric from aggregated forms

  • Activity assessment: Functional recombinant ZDHHC18 can be verified through:

    • In vitro palmitoylation assays using purified substrates (cGAS, HRAS)

    • Acyl-RAC assays to detect palmitoylation of target proteins

    • Co-immunoprecipitation experiments to confirm substrate binding

When producing recombinant ZDHHC18 for biochemical studies, it's crucial to validate that the recombinant protein maintains its native subcellular localization pattern and catalytic activity to ensure physiologically relevant results.

How can researchers accurately measure ZDHHC18-mediated palmitoylation in various experimental contexts?

Accurate measurement of ZDHHC18-mediated palmitoylation requires robust methodologies tailored to different experimental contexts. Researchers can employ several complementary approaches:

For cell-based systems:

  • Acyl-RAC (Resin-Assisted Capture) assay: This method has been successfully used to detect ZDHHC18-mediated palmitoylation of cGAS in HEK293T cells. The protocol involves:

    • Blocking free thiols with N-ethylmaleimide

    • Treating samples with hydroxylamine to cleave thioester bonds

    • Capturing newly exposed thiols using thiol-reactive resins

    • Western blot analysis of captured proteins

  • Metabolic labeling: Incorporation of alkyne-palmitate analogs followed by click chemistry:

    • Cells expressing ZDHHC18 and substrate proteins are incubated with alkyne-palmitate

    • After cell lysis, click chemistry is performed to attach fluorescent or biotin tags

    • Visualization is achieved through in-gel fluorescence or streptavidin pulldown

  • Biotin-switch technique: An alternative approach involving:

    • Blocking free thiols with N-ethylmaleimide

    • Cleaving palmitoyl thioester bonds with hydroxylamine

    • Labeling newly exposed thiols with biotin-BMCC

    • Detection via streptavidin pulldown and western blotting

For functional assessment:

  • Subcellular localization analysis: Palmitoylation by ZDHHC18 can alter protein localization, as demonstrated for HRAS translocation to the plasma membrane. Techniques include:

    • Confocal microscopy with fluorescently tagged proteins

    • Subcellular fractionation followed by western blotting

  • Dimerization assays: For proteins like cGAS where palmitoylation affects dimerization:

    • FRET (Förster resonance energy transfer) analysis using GFP and mCherry fusion proteins

    • Measured FRET efficiency correlates with dimerization status

    • Treatment with palmitoylation inhibitors (2-BP) or enhancers (palmitic acid) confirms specificity

  • DNA binding analysis: For nucleic acid-binding proteins affected by palmitoylation:

    • ISD (IFN-stimulatory DNA) pull-down assay using biotin-labeled DNA

    • Streptavidin agarose capture of protein-DNA complexes

    • Western blot detection of associated proteins

For quantitative measurements:

  • LC-MS/MS analysis: Provides quantitative assessment of palmitoylation and functional outcomes:

    • Direct measurement of palmitoylated peptides

    • Quantification of secondary products (e.g., cGAMP production by cGAS)

To ensure specificity for ZDHHC18-mediated palmitoylation, researchers should implement appropriate controls:

  • ZDHHC18 knockdown or knockout

  • Catalytically inactive ZDHHC18(CS) mutant expression

  • Substrate mutations at palmitoylation sites (e.g., C474S in cGAS)

What in vivo models are most appropriate for studying ZDHHC18 function in disease contexts?

The selection of appropriate in vivo models is crucial for understanding ZDHHC18's role in disease pathogenesis and evaluating its potential as a therapeutic target. Based on current research, several model systems have proven valuable:

Renal Fibrosis Models:

  • Unilateral Ureteral Obstruction (UUO) model:

    • Established model that recapitulates key features of renal fibrosis

    • Used successfully to demonstrate ZDHHC18 upregulation during fibrosis progression

    • Compatible with tubule-specific ZDHHC18 deletion approaches

  • Folic Acid-induced (FA-induced) renal fibrosis model:

    • Alternative chemical induction model

    • Confirms findings from UUO model, strengthening confidence in results

    • Allows assessment of ZDHHC18's role in chemically-induced fibrosis

Genetic Manipulation Approaches:

  • Conditional knockout mice:

    • Tubule-specific deletion of ZDHHC18 using Cre-lox technology

    • Enables tissue-specific assessment of ZDHHC18 function

    • Demonstrated to attenuate tubular epithelial cells' partial EMT and reduce fibrosis

  • Complete Zdhhc18-deficient mice:

    • Global knockout model for systemic effects

    • Shown to be resistant to infection by DNA viruses

    • Validates negative regulatory role in cGAS-mediated immunity

Infection Models:

  • DNA virus infection models:

    • Assess the role of ZDHHC18 in antiviral immune responses

    • Zdhhc18-deficient mice show enhanced resistance to DNA virus infections

    • Confirms the negative regulatory role of ZDHHC18 in cGAS-mediated immunity

Translation to Human Disease:

  • Human CKD tissue analysis:

    • Examination of ZDHHC18 expression in microdissected kidney samples

    • Correlation with clinical parameters (sCr, BUN, eGFR)

    • Verification of findings from animal models in human disease contexts

When designing in vivo studies of ZDHHC18, researchers should consider:

  • Temporal dynamics: Analyzing ZDHHC18 expression and function at different stages of disease progression

  • Cell type specificity: Using conditional knockouts to distinguish roles in different cell populations

  • Combinatorial approaches: Assessing interactions between ZDHHC18 and other disease-relevant pathways

  • Intervention timing: Determining whether ZDHHC18 inhibition can reverse established disease or only prevent progression

These considerations will help maximize the translational relevance of findings from animal models to human disease contexts.

What therapeutic strategies could target ZDHHC18 for treating fibrotic kidney disease?

Given ZDHHC18's established role in promoting renal fibrosis, several therapeutic strategies could be developed to target this enzyme:

  • Small molecule inhibitors: Development of selective ZDHHC18 inhibitors represents a promising approach. Such inhibitors could be designed to:

    • Target the catalytic DHHC domain to prevent palmitoylation activity

    • Disrupt protein-protein interactions with specific substrates like HRAS

    • Modulate ZDHHC18 localization to prevent access to substrates

  • Antisense oligonucleotides (ASOs): These could reduce ZDHHC18 expression by targeting its mRNA:

    • Kidney-targeted delivery systems could enhance specificity

    • Studies have demonstrated that ZDHHC18 knockdown attenuates fibrosis, supporting this approach

  • siRNA/shRNA therapeutics: RNA interference approaches could silence ZDHHC18 expression:

    • Encapsulation in nanoparticles for kidney delivery

    • Conjugation with kidney-homing peptides for targeted delivery

    • ZDHHC18 knockdown has been validated to enhance innate immune responses and potentially reduce fibrosis

  • Substrate-specific intervention: Targeting the ZDHHC18-HRAS interaction specifically:

    • Peptide inhibitors mimicking binding interfaces

    • Small molecules that prevent HRAS palmitoylation without affecting other ZDHHC18 substrates

    • This approach could minimize off-target effects on innate immunity

  • Downstream pathway modulators: Targeting the consequences of ZDHHC18-mediated palmitoylation:

    • MEK/ERK inhibitors to block signaling downstream of palmitoylated HRAS

    • RREB1 inhibitors to prevent SMAD binding to profibrotic gene regulatory regions

    • Combined approach with partial ZDHHC18 inhibition for synergistic effects

The therapeutic potential of ZDHHC18 inhibition is supported by evidence that tubule-specific deletion of ZDHHC18 attenuates tubular epithelial cells' partial EMT and reduces the production of profibrotic cytokines, ultimately alleviating tubulointerstitial fibrosis in mouse models .

Challenges to address in developing ZDHHC18-targeted therapies include:

  • Ensuring specificity among the 23 DHHC family members

  • Balancing effects on both fibrosis and innate immunity pathways

  • Developing kidney-specific delivery systems to minimize systemic effects

How might targeting ZDHHC18 affect innate immune responses in therapeutic contexts?

Targeting ZDHHC18 for therapeutic purposes requires careful consideration of its dual roles in fibrosis and innate immunity. The effects on innate immune responses are particularly important to understand for developing balanced therapeutic approaches:

  • Enhanced antiviral immunity: ZDHHC18 inhibition would likely enhance cGAS-mediated innate immune responses, which could have both beneficial and potentially adverse effects:

    • Beneficial aspects: Improved viral clearance and resistance to DNA virus infections, as demonstrated in Zdhhc18-deficient mice

    • Potential concerns: Excessive type I interferon production leading to inflammatory conditions or autoimmunity

  • Tissue-specific effects: Different tissues may respond distinctly to ZDHHC18 modulation:

    • In kidneys, ZDHHC18 inhibition could reduce fibrosis while simultaneously enhancing local innate immunity

    • In immune cells, effects might be more pronounced on antiviral responses

  • Interaction with existing immunotherapies: Consideration of how ZDHHC18 targeting would interact with:

    • Immunosuppressive drugs commonly used in kidney disease

    • Checkpoint inhibitors in cancer treatment

    • Antiviral therapies

  • Temporal considerations: Short-term versus long-term effects of ZDHHC18 inhibition:

    • Acute enhancement of innate immunity might be beneficial during infection

    • Chronic enhancement could potentially contribute to inflammatory conditions

  • Stratification of patient populations: Identifying patients most likely to benefit:

    • Those with concurrent viral infections and fibrotic disease might benefit from enhanced immunity

    • Patients with autoimmune tendencies might require careful monitoring

Experimental evidence indicates that ZDHHC18 knockdown reinforces cGAS activation and enhances ISD-induced innate immune signaling in THP-1 cells . Additionally, Zdhhc18-deficient mice demonstrate resistance to DNA virus infection, confirming the negative regulatory role of ZDHHC18 in cGAS-mediated innate immunity .

A balanced therapeutic approach might include:

  • Tissue-targeted delivery of ZDHHC18 inhibitors to fibrotic kidneys

  • Adjustable dosing regimens to fine-tune immune responses

  • Combination therapies that counteract excessive immune activation if needed

  • Biomarker development to monitor both fibrosis regression and immune system activation

What biomarkers could be developed to monitor ZDHHC18 activity in patient samples?

Developing reliable biomarkers to monitor ZDHHC18 activity would significantly enhance both research capabilities and clinical applications. Several promising biomarker approaches could be explored:

  • Direct ZDHHC18 expression measurements:

    • Tissue biopsy analysis: Immunohistochemistry for ZDHHC18 in kidney biopsies has already shown correlation with disease severity in CKD patients

    • mRNA expression: RT-qPCR analysis of ZDHHC18 transcript levels in microdissected kidney samples

    • Single-cell RNA sequencing: To determine cell type-specific expression patterns in heterogeneous tissues

  • Substrate palmitoylation status:

    • HRAS palmitoylation: Developing antibodies specific to palmitoylated HRAS

    • HRAS membrane localization: As a surrogate marker for palmitoylation in tissue sections

    • cGAS palmitoylation: Particularly relevant in immune cells and during viral infections

  • Downstream signaling markers:

    • MEK/ERK phosphorylation: As indicators of palmitoylated HRAS activity

    • RREB1 activation status: Through phospho-specific antibodies

    • SMAD binding to target genes: Using chromatin immunoprecipitation assays

    • Snai1 and Has2 expression levels: As transcriptional targets of the pathway

  • Functional readouts:

    • cGAMP levels: Measurable by LC-MS/MS as indicators of cGAS activity inversely related to ZDHHC18 function

    • Type I interferon signature: Gene expression patterns in blood cells reflecting cGAS pathway activation

    • EMT markers: E-cadherin/vimentin ratio in kidney tissues as indicators of partial EMT driven by ZDHHC18

  • Blood-based biomarkers:

    • Circulating ZDHHC18: Potential release from damaged kidney tissues

    • Extracellular vesicle content: ZDHHC18 or palmitoylated substrate proteins in urinary exosomes

    • Metabolomic signatures: Patterns of lipid metabolites associated with altered palmitoylation

The clinical utility of these biomarkers is supported by observed correlations between ZDHHC18 expression and key clinical parameters in CKD patients:

BiomarkerRelationship to clinical parametersPotential utility
ZDHHC18 tissue expressionPositive correlation with tubular injury score, sCr, BUN; negative correlation with eGFRDisease severity assessment
EMT markers (α-SMA, vimentin)Strong positive correlation with ZDHHC18 expressionMonitoring fibrosis progression
MEK/ERK phosphorylationDownstream of ZDHHC18-HRAS activityTreatment response monitoring

Development of these biomarkers would enable patient stratification, therapeutic monitoring, and personalized treatment approaches targeting ZDHHC18 in kidney fibrosis and potentially other diseases where this enzyme plays a significant role.

What new research directions should be prioritized to better understand ZDHHC18's role in disease pathogenesis?

To advance our understanding of ZDHHC18's contributions to disease pathogenesis and develop effective therapeutic strategies, several key research directions should be prioritized:

  • Comprehensive substrate identification:

    • Proteome-wide screening for ZDHHC18 substrates using bioorthogonal labeling approaches

    • Comparison of palmitoylated proteomes in wild-type versus ZDHHC18-deficient cells and tissues

    • Investigation of substrate specificity determinants and consensus motifs

    • This would extend beyond the currently identified substrates (cGAS and HRAS) to discover new therapeutic targets

  • Structural biology approaches:

    • Determination of ZDHHC18 crystal structure or cryo-EM structure

    • Analysis of substrate binding mechanisms and catalytic site architecture

    • Structure-based drug design for specific ZDHHC18 inhibitors

    • Understanding how membrane topology influences enzyme activity

  • Disease-specific expression and function:

    • Systematic analysis of ZDHHC18 expression across various fibrotic diseases (liver, lung, skin)

    • Investigation of ZDHHC18 in additional immune-related conditions (autoimmunity, cancer immunity)

    • Single-cell analysis of ZDHHC18 expression in heterogeneous disease tissues

    • Correlation with clinical outcomes in larger patient cohorts

  • Regulatory mechanisms:

    • Identification of transcriptional, post-transcriptional, and post-translational regulators of ZDHHC18

    • Investigating how disease states alter ZDHHC18 regulation

    • Understanding tissue-specific expression patterns and their functional significance

    • Determining how ZDHHC18 activity is modulated during different phases of disease progression

  • Development of specific probes and inhibitors:

    • Design of activity-based probes for ZDHHC18

    • High-throughput screening for selective ZDHHC18 inhibitors

    • Validation in cellular and animal models of disease

    • Optimization of pharmacokinetic properties for kidney-targeted delivery

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data to understand ZDHHC18's impact on cellular networks

    • Mathematical modeling of how ZDHHC18-mediated palmitoylation affects signaling dynamics

    • Prediction of potential combination therapy approaches targeting multiple nodes in ZDHHC18-related pathways

  • Genetic studies in human populations:

    • Identification of ZDHHC18 variants associated with fibrotic diseases or immune disorders

    • Functional characterization of these variants

    • Potential development of personalized medicine approaches based on genetic profiles

These research directions would significantly enhance our understanding of ZDHHC18 biology and accelerate the development of therapeutic strategies targeting this enzyme in various disease contexts, particularly renal fibrosis and conditions involving dysregulated innate immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.