Recombinant Human Palmitoyltransferase ZDHHC2 (ZDHHC2)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

ZDHHC2 employs a "ping-pong" kinetic mechanism:

  1. Auto-palmitoylation: Palmitoyl-CoA binds to the DHHC motif, forming a palmitoyl-enzyme intermediate .

  2. Substrate transfer: Palmitoyl group transfers to a cysteine thiol on target proteins, releasing ZDHHC2 to its original state .

Substrate Specificity:
ZDHHC2 preferentially palmitoylates cysteine residues in proteins like AGK, B-RAF/C-RAF, and TLR2, influencing their membrane localization and signaling .

Cancer Progression

ZDHHC2 is upregulated in sunitinib-resistant clear cell renal carcinoma (ccRCC) and mediates resistance via:

  • AGK palmitoylation: Promotes AGK plasma membrane localization, activating the PI3K-AKT-mTOR pathway .

  • Mechanistic Impact:

    ProcessEffectSource
    AGK S-palmitoylationEnhances AKT/S6K1 phosphorylation
    Sunitinib resistanceReduces drug efficacy in ccRCC

Immune Response

ZDHHC2 modulates antimicrobial immunity against Mycobacterium tuberculosis:

  • B-RAF/C-RAF palmitoylation: Prevents their autophagic degradation, sustaining pro-inflammatory cytokine production (e.g., IL-6, IL-1β) .

  • Clinical Relevance: ZDHHC2 knockout mice show impaired bacterial clearance and reduced MGC formation .

TLR Signaling

Palmitoylates TLR2 (Cys609), enhancing its cell surface expression and NF-κB-dependent pro-inflammatory signaling .

Key Catalytic Residues and Domains

Domain/ResidueFunctionSource
Cys156 (DHHC motif)Catalytic site for palmitoyl transfer
DHHC-CRDZinc coordination, structural stability
Zinc fingersStabilizes CRD despite zinc-independent folding

Regulation by Accessory Proteins

Some zDHHC-PATs require chaperones for substrate specificity, but ZDHHC2’s accessory partners remain poorly characterized .

Chemical Genetic Systems

ZDHHC2 has been studied using:

  • YnPal labeling: Identifies substrates via metabolic tagging of palmitoylated proteins .

  • CRISPR screens: Maps ZDHHC2-dependent palmitoylation sites (e.g., AGK in ccRCC) .

MethodApplicationSource
Acyl-biotinyl exchange (ABE)Detects palmitoylated AGK in ccRCC cells
Click chemistryVisualizes endogenous B-RAF/C-RAF palmitoylation

Targeted Therapies

  • Cancer: Inhibiting ZDHHC2 may restore sunitinib sensitivity in ccRCC by blocking AKT-mTOR activation .

  • Infectious Diseases: Enhancing ZDHHC2 activity could potentiate antimycobacterial responses .

Challenges

  • Substrate Specificity: Lack of consensus motifs complicates drug design .

  • Off-Target Effects: Broad zDHHC inhibition may disrupt essential palmitoylation processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZDHHC2; REAM; REC; ZNF372; Palmitoyltransferase ZDHHC2; Acyltransferase ZDHHC2; Reduced expression associated with metastasis protein; Ream; Reduced expression in cancer protein; Rec; Zinc finger DHHC domain-containing protein 2; DHHC-2; Zinc finger protein 372
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC2
Target Protein Sequence
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH LLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTR TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL LYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNK STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ DPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPGKCKAGMSNPA LTMENET
Uniprot No.

Target Background

Function
ZDHHC2 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates, participating in diverse cellular processes. It exhibits broad fatty acid selectivity, transferring myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA onto target proteins in addition to palmitate. In the nervous system, ZDHHC2 contributes to long-term synaptic potentiation by palmitoylating AKAP5, regulating protein trafficking from dendritic recycling endosomes to the plasma membrane and influencing structural and functional plasticity at excitatory synapses. In dendrites, it mediates DLG4 palmitoylation upon decreased synaptic activity, inducing synaptic clustering of DLG4 and associated AMPA-type glutamate receptors. It also mediates the de novo and turnover palmitoylation of RGS7BP, a shuttle for Gi/o-specific GTPase-activating proteins (GAPs), promoting its plasma membrane localization in response to G protein-coupled receptor activation. This localization of GAPs likely plays a role in G protein-coupled receptor signaling in neurons. ZDHHC2 may also participate in cell adhesion by palmitoylating CD9 and CD151, regulating their expression and function. It palmitoylates the endoplasmic reticulum protein CKAP4, regulating its plasma membrane localization and may also palmitoylate LCK, regulating its plasma membrane localization. Furthermore, ZDHHC2 promotes Chikungunya virus (CHIKV) replication by mediating viral nsp1 palmitoylation.
Gene References Into Functions
  1. ZDHHC2's role as a tumor suppressor in hepatocellular carcinoma (HCC) metastasis and recurrence. PMID: 24995331
  2. Reduced ZDHHC2 expression correlates with lymph node metastasis and predicts poor prognosis in gastric adenocarcinoma. PMID: 23457560
  3. DHHC2's primary localization to the endoplasmic reticulum and Golgi apparatus suggests involvement in the S-acylation of newly synthesized or recycling Lck in T cell signaling. PMID: 22034844
  4. DHHC2's targeting of a dynamic membrane cycling pathway, regulated by a C-terminal domain. PMID: 21471008
  5. Gi/o signaling and DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein. PMID: 21343290
  6. DHHC2's effects on palmitoylation, stability, and function of tetraspanins CD9 and CD151. PMID: 18508921
Database Links

HGNC: 18469

KEGG: hsa:51201

STRING: 9606.ENSP00000262096

UniGene: Hs.728241

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Cell junction, synapse, postsynaptic density. Postsynaptic recycling endosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Reduced expression in colorectal cancers with liver metastasis.

Q&A

What is ZDHHC2 and what are its primary biological functions?

ZDHHC2 (Zinc Finger DHHC-Type Containing 2) is a palmitoyl acyltransferase (PAT) enzyme containing the conserved Asp-His-His-Cys (DHHC) motif responsible for catalyzing protein S-palmitoylation. This post-translational modification involves the addition of a 16-carbon saturated fatty acid (palmitate) to cysteine residues of target proteins, which significantly alters protein localization, stability, and function .

ZDHHC2 serves several important biological functions including:

  • Regulation of protein trafficking between cellular compartments

  • Control of protein subcellular localization, particularly promoting plasma membrane association

  • Modulation of intracellular signaling pathways, notably the PI3K-AKT-mTOR axis

  • Involvement in cancer progression through effects on cell proliferation, invasion, and drug sensitivity

  • Potential tumor suppressor activity in certain cancer types, including hepatocellular carcinoma

The versatility of ZDHHC2 in regulating diverse cellular processes makes it an important target for basic research investigations and potential therapeutic development.

What is the subcellular localization of ZDHHC2?

Unlike most DHHC family proteins that primarily localize to endoplasmic reticulum (ER) or Golgi membranes, ZDHHC2 exhibits a more dynamic subcellular distribution. Studies reveal that ZDHHC2 associates with multiple membrane compartments :

  • Plasma membrane - ZDHHC2 incorporates into the plasma membrane with demonstrated integration confirmed by labeling of an extrafacial HA epitope in non-permeabilized cells

  • Recycling endosomes - ZDHHC2 colocalizes with Rab11-positive recycling endosomal compartments

  • Vesicular structures - ZDHHC2 is found in dendritic vesicles, particularly in neuronal cells

  • Dynamic trafficking - ZDHHC2 cycles between plasma membrane and intracellular compartments

Fluorescence recovery after photobleaching (FRAP) analysis has confirmed this dynamic localization pattern, revealing constitutive refilling of the recycling endosome pool of ZDHHC2. This unique localization pattern allows ZDHHC2 to access a diverse array of substrate proteins and potentially regulate their function through palmitoylation at different cellular sites .

How do researchers express and purify recombinant ZDHHC2 for functional studies?

Expression and purification of recombinant ZDHHC2 typically follows these methodological steps:

  • Construct design: The coding sequence of ZDHHC2 is PCR-amplified and inserted into an appropriate expression vector. For example, researchers have inserted ZDHHC2 into the XhoI/KpnI sites of the GV230 vector with an EGFP tag to monitor expression .

  • Primer design: Typical primers for ZDHHC2 amplification include:

    • Forward: 5′-TCCGCTCGAGATGGCGCCCTCGGGCC-3′

    • Reverse: 5′-ATGGGGTACCGTAGTCTCATTTTCCATGGTTAATG-3′

  • Transfection methods: Lipofectamine 2000 is commonly used for introducing the expression constructs into mammalian cell lines following manufacturer's protocols .

  • Validation of expression: Western blot analysis using ZDHHC2-specific antibodies (such as AP5592a from Abgent) confirms proper expression of the recombinant protein.

  • Functional verification: Activity of the recombinant ZDHHC2 can be assessed through palmitoylation assays, such as the acyl-biotinyl exchange (ABE) technique with biotin-HPDP or click chemistry-based methods using biotin alkyne labeling .

For experimental controls, enzymatically inactive ZDHHC2 mutants (such as C129A) can be expressed in parallel to validate palmitoylation-specific effects .

How does ZDHHC2 contribute to cancer progression and drug resistance mechanisms?

ZDHHC2 plays complex and sometimes contradictory roles in cancer biology, functioning as either an oncogenic driver or tumor suppressor depending on the cancer type. Research has revealed several key mechanisms:

In clear cell renal cell carcinoma (ccRCC):

  • ZDHHC2 is abnormally upregulated in tissues and cell lines resistant to tyrosine kinase inhibitors (TKIs) such as sunitinib

  • It catalyzes AGK S-palmitoylation, promoting AGK translocation to the plasma membrane

  • This activates the PI3K-AKT-mTOR signaling pathway, contributing to sunitinib resistance

  • Overexpression of ZDHHC2 decreases apoptosis after sunitinib treatment

In hepatocellular carcinoma (HCC):

  • ZDHHC2 functions as a tumor suppressor

  • Loss of heterozygosity (LOH) on ZDHHC2 is associated with early metastatic recurrence following liver transplantation

  • LOH correlates with larger tumor size and portal vein tumor thrombi

  • ZDHHC2 expression is frequently decreased in HCC tissues

  • Overexpression of ZDHHC2 inhibits proliferation, migration, and invasion of HCC cell lines in vitro

Functional analysis using the CancerSEA dataset has shown that ZDHHC2 is involved in:

  • Promoting epithelial-mesenchymal transition (EMT)

  • Enhancing cellular proliferation

  • Positively correlating with hypoxia and angiogenesis, potentially explaining its association with TKI resistance

These divergent roles highlight the context-dependent nature of ZDHHC2 function in cancer biology, necessitating careful characterization in each specific cancer type.

What experimental approaches can detect and quantify ZDHHC2-mediated protein palmitoylation?

Researchers employ several complementary methodologies to detect and quantify ZDHHC2-mediated protein palmitoylation:

  • Acyl-Biotinyl Exchange (ABE) technique:

    • This method replaces palmitoyl modifications with biotin labels

    • Proteins are treated with N-ethylmaleimide to block free thiols

    • Hydroxylamine (NH2OH) specifically cleaves thioester bonds

    • Newly exposed thiols are labeled with biotin-HPDP

    • Biotinylated proteins are captured with streptavidin and analyzed by immunoblotting

  • Click chemistry-based detection:

    • Metabolic labeling with alkyne-modified palmitate analogs

    • Click reaction links biotin-azide to alkyne-modified proteins

    • Biotinylated proteins are captured with streptavidin beads

    • This approach detected that approximately 20% of AGK could be palmitoylated in 786-O and A498 cells

  • Subcellular fractionation analysis:

    • Plasma membrane proteins are isolated using extraction kits

    • Immunoblotting confirms absence of cross-contamination between fractions

    • This approach revealed that ZDHHC2 silencing significantly reduced AGK plasma membrane localization

  • Mutational analysis:

    • Site-directed mutagenesis of putative palmitoylation sites (e.g., AGK-C72S)

    • Comparison of wild-type versus mutant protein localization and function

    • For example, AGK-C72S showed reduced plasma membrane localization compared to wild-type AGK

The combination of these approaches provides comprehensive evidence for ZDHHC2-mediated palmitoylation and its functional consequences on substrate proteins.

How can researchers develop ZDHHC2-targeted therapeutic approaches for cancer treatment?

Developing ZDHHC2-targeted therapeutic approaches requires several methodological considerations:

  • Target validation strategies:

    • CRISPR/Cas9-mediated knockout of ZDHHC2 in resistant cancer cell lines

    • Assessment of phenotypic changes in proliferation, invasion, and drug sensitivity

    • Rescue experiments with wild-type versus catalytically inactive ZDHHC2 mutants

    • In vivo validation using xenograft models to confirm therapeutic potential

  • Potential therapeutic approaches:

    • Small molecule inhibitors targeting ZDHHC2 catalytic activity

    • Combination therapy with existing drugs (e.g., sunitinib plus ZDHHC2 inhibitors for ccRCC)

    • Palmitoylation inhibitors such as 2-bromopalmitate (2-BP) that attenuate ZDHHC2-induced drug resistance

    • RNA interference or antisense oligonucleotides to downregulate ZDHHC2 expression

  • Cancer-specific considerations:

    • In ccRCC: ZDHHC2 inhibition could overcome sunitinib resistance

    • In HCC: ZDHHC2 appears to function as a tumor suppressor, so therapeutic approaches might involve restoring ZDHHC2 expression

  • Biomarker development:

    • ZDHHC2 expression levels could serve as predictive biomarkers for drug response

    • Correlation between ZDHHC2 expression and phosphorylated AKT (pAKT S473) might predict pathway activation and guide treatment selection

The effectiveness of ZDHHC2-targeted therapies would likely depend on cancer type, stage, and molecular context, emphasizing the need for personalized medicine approaches.

What are the critical controls needed for ZDHHC2 functional studies?

When conducting ZDHHC2 functional studies, several essential controls should be incorporated:

  • Enzymatic activity controls:

    • ZDHHC2 catalytic dead mutant (C129A) - This mutant lacks palmitoyl transferase activity but maintains protein structure, serving as a critical negative control for palmitoylation-dependent functions

    • Studies have confirmed that C129A mutants fail to induce sunitinib resistance, unlike wild-type ZDHHC2

  • Palmitoylation inhibition controls:

    • 2-bromopalmitate (2-BP) treatment - A broad-spectrum palmitoylation inhibitor that helps distinguish palmitoylation-dependent versus independent effects

    • Research shows 2-BP treatment attenuates ZDHHC2-induced sunitinib resistance

  • Subcellular localization controls:

    • Subcellular fraction purity verification - When isolating membrane fractions, validation with compartment-specific markers ensures no cross-contamination

    • For ZDHHC2 trafficking studies, plasma membrane, recycling endosome, and ER markers help confirm localization patterns

  • Substrate specificity controls:

    • Palmitoylation-site mutant substrates (e.g., AGK-C72S) - These mutants help confirm the specific cysteine residues modified by ZDHHC2

    • Testing multiple potential ZDHHC substrates helps establish specificity profiles

  • Expression system controls:

    • Empty vector controls - Essential when overexpressing ZDHHC2 to account for non-specific effects

    • Rescue experiments in ZDHHC2 knockout backgrounds provide strong evidence for specificity

How can researchers distinguish ZDHHC2-specific palmitoylation from modifications by other DHHC family members?

Distinguishing ZDHHC2-specific palmitoylation from modifications by other DHHC family members presents a significant challenge due to potential functional redundancy. Researchers can employ these methodological approaches:

  • Comprehensive DHHC family screening:

    • CRISPR screen targeting all 23 human DHHC family members

    • Assessment of palmitoylation levels of the substrate of interest following each DHHC knockout

    • This approach helps identify which DHHC enzymes can modify a specific substrate

  • In vitro palmitoylation assays:

    • Purified recombinant ZDHHC2 versus other DHHC proteins

    • Direct comparison of palmitoylation efficiency for specific substrates

    • Kinetic analysis to determine substrate preferences

  • Substrate binding studies:

    • Co-immunoprecipitation experiments to assess direct interactions

    • Proximity ligation assays to confirm in vivo associations

    • These approaches help determine if substrate recognition involves direct binding

  • Domain swap experiments:

    • Construction of chimeric proteins between ZDHHC2 and related enzymes (e.g., ZDHHC15)

    • This approach revealed that C-terminal domains regulate membrane targeting and potentially substrate specificity

  • Subcellular localization analysis:

    • Different DHHC enzymes occupy distinct subcellular compartments

    • ZDHHC2's unique dynamic localization (plasma membrane/recycling endosomes) may give it access to substrate pools unavailable to other family members

    • Colocalization studies help determine which substrates physically encounter ZDHHC2 versus other DHHCs

These approaches, particularly when used in combination, help delineate the unique substrate profile of ZDHHC2 versus other palmitoyl transferases.

What is the prognostic significance of ZDHHC2 expression in different cancer types?

The prognostic significance of ZDHHC2 varies dramatically between cancer types, highlighting its context-dependent roles:

In hepatocellular carcinoma (HCC):

  • Loss of heterozygosity (LOH) on ZDHHC2 is associated with early metastatic recurrence following liver transplantation

  • ZDHHC2 LOH correlates with larger tumor size and presence of portal vein tumor thrombi

  • Expression is frequently decreased in HCC tissues

  • These findings suggest ZDHHC2 functions as a tumor suppressor in HCC, with lower expression predicting worse outcomes

In clear cell renal cell carcinoma (ccRCC):

  • ZDHHC2 is abnormally upregulated in tissues and cell lines resistant to tyrosine kinase inhibitors

  • Higher ZDHHC2 expression correlates with reduced sunitinib sensitivity

  • ZDHHC2 upregulation is associated with increased PI3K-AKT-mTOR pathway activation

  • There is a positive correlation between ZDHHC2 and phosphorylated AKT (pAKT S473) levels

  • These data suggest ZDHHC2 contributes to drug resistance and potentially worse outcomes in ccRCC

The prognostic significance can be quantitatively assessed using immunohistochemistry scoring systems:

  • Staining intensity scale: 0 (none), 1 (weak), 2 (moderate), 3 (strong)

  • Percentage of positive cells: 0 (<5%), 1 (5-25%), 2 (26-50%), 3 (51-75%), 4 (>75%)

  • Composite score: multiplication of intensity and percentage values

Statistical analysis using Kaplan-Meier method and multivariate Cox proportional hazard models can determine independent prognostic value of ZDHHC2 expression or LOH status for specific cancer types .

How does ZDHHC2 contribute to drug resistance mechanisms in cancer therapy?

ZDHHC2 contributes to drug resistance through several interconnected molecular mechanisms:

  • Activation of PI3K-AKT-mTOR signaling pathway:

    • ZDHHC2 catalyzes AGK S-palmitoylation

    • Palmitoylated AGK translocates to the plasma membrane

    • This activates the PI3K-AKT-mTOR pathway, promoting cell survival

    • Transcriptome analysis and KEGG enrichment confirm ZDHHC2 modulation of this pathway

  • Regulation of angiogenesis and hypoxia responses:

    • ZDHHC2 positively correlates with hypoxia and angiogenesis signatures

    • This may counteract the anti-angiogenic effects of tyrosine kinase inhibitors like sunitinib

    • Cancer single-cell state atlas (CancerSEA) analysis confirms these associations

  • Epithelial-mesenchymal transition (EMT) promotion:

    • ZDHHC2 involvement in EMT may increase invasiveness and decrease drug sensitivity

    • This contributes to a more aggressive cancer phenotype resistant to standard therapies

  • Anti-apoptotic effects:

    • ZDHHC2 knockout promotes apoptosis after sunitinib treatment

    • Overexpression of ZDHHC2 decreases apoptosis, enhancing cell survival

    • This directly impacts cancer cell response to therapy

The importance of ZDHHC2's enzymatic activity in drug resistance is demonstrated by:

  • ZDHHC2 enzymatically dead mutant (C129A) fails to induce sunitinib resistance

  • Palmitoylation inhibitor 2-BP attenuates ZDHHC2-induced resistance

  • These findings confirm that ZDHHC2's catalytic activity is essential for its role in drug resistance

These mechanisms collectively position ZDHHC2 as a potential therapeutic target to overcome drug resistance in certain cancer types.

What methods can detect ZDHHC2 gene alterations in clinical samples?

Researchers employ several complementary methodologies to detect ZDHHC2 gene alterations in clinical samples:

  • Loss of heterozygosity (LOH) analysis:

    • PCR amplification of microsatellite markers near the ZDHHC2 locus on chromosome 8p22-p23

    • Comparison of band patterns between tumor and adjacent normal tissue

    • LOH is indicated by reduction or absence of one allele in tumor samples compared to matched normal tissue

    • This technique has revealed significant LOH rates for ZDHHC2 in hepatocellular carcinoma

  • Expression analysis methods:

    • Quantitative RT-PCR to measure ZDHHC2 mRNA levels

    • Immunohistochemistry (IHC) for protein expression using specific antibodies (e.g., AP5592a, Abgent)

    • Semi-quantitative IHC scoring system:

      • Intensity: 0 (no staining) to 3 (strong staining)

      • Abundance: 0 (<5% positive cells) to 4 (>75% positive cells)

      • Composite score: multiplication of intensity and abundance values

  • Next-generation sequencing approaches:

    • Targeted gene panels including ZDHHC2

    • Whole exome sequencing to detect mutations, deletions, or amplifications

    • RNA-seq for expression and splice variant analysis

  • Functional correlation analyses:

    • Correlation of ZDHHC2 status with activation of downstream pathways

    • For example, positive correlation between ZDHHC2 and pAKT S473 levels in clinical samples provides functional validation

  • Statistical analysis of clinical significance:

    • Chi-square test or Fisher exact test for comparisons between genetic alterations and clinicopathological parameters

    • Kaplan-Meier method for cumulative recurrence-free survival assessment

    • Cox proportional hazard model for multivariate analysis of independent prognostic factors

These methodologies provide comprehensive assessment of ZDHHC2 genetic status in clinical samples and its relationship to disease progression and outcome.

What are the emerging techniques for studying ZDHHC2 function and regulatory mechanisms?

Several cutting-edge techniques are advancing our understanding of ZDHHC2 function and regulation:

  • Proteome-wide palmitoylation profiling:

    • Metabolic labeling with palmitate analogs coupled with click chemistry

    • Mass spectrometry identification of palmitoylated proteins

    • Comparison between wild-type and ZDHHC2-deficient cells to identify the complete substrate repertoire

    • This approach could reveal novel ZDHHC2 substrates beyond currently known targets like AGK

  • CRISPR/Cas9-based functional genomics:

    • Genome-wide CRISPR screens to identify genetic interactions with ZDHHC2

    • CRISPR activation/inhibition systems to modulate ZDHHC2 expression

    • Base editing or prime editing to introduce specific mutations without double-strand breaks

    • These approaches help elucidate regulatory networks and functional interactions

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize ZDHHC2 trafficking at nanoscale resolution

    • Fluorescence resonance energy transfer (FRET) to detect enzyme-substrate interactions

    • Optogenetic control of ZDHHC2 activity or localization

    • Live-cell imaging to track dynamic palmitoylation events in real-time

  • Structural biology approaches:

    • Cryo-electron microscopy to determine ZDHHC2 structure

    • Molecular dynamics simulations to understand substrate recognition

    • Structure-guided design of specific inhibitors

    • These approaches could reveal mechanistic insights and facilitate drug development

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in ZDHHC2 expression

    • Single-cell proteomics to correlate ZDHHC2 levels with pathway activation

    • Spatial transcriptomics to map ZDHHC2 expression in tissue context

    • These methods help understand cellular heterogeneity in complex tissues

These emerging technologies promise to significantly advance our understanding of ZDHHC2 biology and potentially identify new therapeutic strategies targeting this enzyme.

How can researchers investigate crosstalk between ZDHHC2 and other post-translational modifications?

Investigating the interplay between ZDHHC2-mediated palmitoylation and other post-translational modifications (PTMs) requires sophisticated experimental approaches:

  • Multi-PTM detection strategies:

    • Sequential enrichment protocols for different modifications

    • Multiplexed mass spectrometry to identify co-occurring PTMs

    • Site-specific antibodies recognizing both palmitoylation and other modifications

    • These approaches can identify proteins that undergo both palmitoylation and other modifications

  • Mutational analysis of modification sites:

    • Site-directed mutagenesis of potential PTM sites

    • Creation of phosphomimetic mutations (e.g., S/T to D/E) to simulate phosphorylation

    • Analysis of how one modification affects another (e.g., does phosphorylation near a cysteine affect its palmitoylation?)

    • For example, investigating if AGK palmitoylation is regulated by nearby phosphorylation events

  • Temporal dynamics studies:

    • Pulse-chase experiments to determine sequence of modifications

    • Inducible systems to trigger specific modifications

    • Time-resolved proteomics to capture modification cascades

    • These approaches reveal whether modifications occur sequentially or independently

  • Pathway inhibition experiments:

    • Selective inhibition of kinases, deacetylases, or other PTM enzymes

    • Assessment of how inhibiting one modification pathway affects ZDHHC2-mediated palmitoylation

    • Analysis of whether ZDHHC2 inhibition impacts other PTM pathways

    • For example, examining how PI3K/AKT pathway inhibitors affect palmitoylation patterns

  • Computational prediction and modeling:

    • Algorithms to predict PTM crosstalk based on sequence context

    • Structural modeling of how multiple modifications affect protein conformation

    • Network analysis to identify common regulators of different PTM pathways

    • These approaches generate hypotheses for experimental validation

Understanding PTM crosstalk will provide insights into the complex regulatory networks governing protein function and potentially reveal new therapeutic approaches targeting specific modification patterns.

What are the most promising translational applications of ZDHHC2 research?

Based on current research findings, several promising translational applications of ZDHHC2 research are emerging:

  • Overcoming drug resistance in cancer therapy:

    • Development of ZDHHC2 inhibitors as sensitizing agents for tyrosine kinase inhibitor therapy

    • In clear cell renal cell carcinoma, ZDHHC2 inhibition could restore sunitinib sensitivity

    • Combinatorial therapy approaches targeting both ZDHHC2 and the PI3K-AKT-mTOR pathway

    • Palmitoylation inhibitors could serve as adjuvant therapy to conventional cancer treatments

  • Biomarker development for precision medicine:

    • ZDHHC2 expression levels as predictive biomarkers for drug response

    • ZDHHC2 gene alterations (LOH) as prognostic indicators in certain cancers

    • Assessment of ZDHHC2 palmitoylation targets (e.g., AGK) as surrogate markers for pathway activation

    • Correlation between ZDHHC2 and pAKT S473 for patient stratification

  • Diagnostic applications:

    • Development of immunohistochemistry panels including ZDHHC2 for cancer subtyping

    • Incorporation of ZDHHC2 status in molecular diagnostic algorithms

    • Liquid biopsy approaches to detect ZDHHC2 alterations in circulating tumor DNA

  • Novel therapeutic strategies:

    • For cancers where ZDHHC2 functions as a tumor suppressor (e.g., HCC), therapeutic approaches to restore ZDHHC2 expression

    • For cancers where ZDHHC2 drives progression (e.g., ccRCC), development of specific inhibitors

    • Targeting ZDHHC2 subcellular trafficking as an alternative to direct enzyme inhibition

    • Development of substrate-specific inhibitors blocking palmitoylation of key oncogenic targets

  • Research tools and reagents:

    • Development of ZDHHC2-specific antibodies and probes for research and diagnostic applications

    • Creation of reporter systems for monitoring ZDHHC2 activity in living cells

    • Generation of model systems for drug screening and validation

These translational applications highlight the potential impact of ZDHHC2 research on improving cancer diagnosis, prognosis, and treatment strategies.

What are the recommended experimental workflows for investigating ZDHHC2 in new research models?

When investigating ZDHHC2 in new research models, researchers should consider this comprehensive experimental workflow:

  • Initial characterization:

    • Expression analysis of ZDHHC2 at mRNA and protein levels

    • Subcellular localization determination using fractionation and immunofluorescence

    • Comparison with normal tissue counterparts or control cell lines

    • This establishes the baseline ZDHHC2 profile in the model system

  • Functional perturbation:

    • Generation of ZDHHC2 knockout models using CRISPR/Cas9

    • Creation of stable overexpression cell lines with wild-type and mutant (C129A) ZDHHC2

    • Inducible expression systems for temporal control of ZDHHC2 activity

    • These tools enable causative studies of ZDHHC2 function

  • Phenotypic analysis:

    • Assessment of cellular proliferation, migration, and invasion

    • Drug sensitivity profiling with relevant therapeutic agents

    • Pathway activation analysis focusing on known ZDHHC2-affected pathways (e.g., PI3K-AKT-mTOR)

    • In vivo tumor models where appropriate

    • This reveals the functional impact of ZDHHC2 modulation

  • Substrate identification and validation:

    • Global palmitoylation profiling comparing wild-type and ZDHHC2-deficient models

    • Validation of candidate substrates using ABE or click chemistry methods

    • Site-directed mutagenesis of putative palmitoylation sites on substrates

    • Functional analysis of substrate palmitoylation

    • This identifies the molecular mechanisms underlying ZDHHC2 effects

  • Translational correlation:

    • Analysis of clinical databases for ZDHHC2 expression in relevant disease contexts

    • Correlation with clinical parameters and outcome data

    • Testing of pharmacological inhibitors of ZDHHC2 or related pathways

    • This establishes clinical relevance of findings

Experimental PhaseKey MethodsExpected OutcomesPotential Challenges
Expression AnalysisqRT-PCR, Western blot, IHCBaseline expression profileAntibody specificity
LocalizationSubcellular fractionation, ImmunofluorescenceCompartment-specific distributionCross-contamination of fractions
Functional ManipulationCRISPR/Cas9, OverexpressionGain/loss of function modelsOff-target effects
Phenotypic AssessmentProliferation, migration, drug response assaysFunctional consequencesModel-specific variations
Substrate IdentificationABE, click chemistry, proteomicsZDHHC2-specific targetsDistinguishing direct vs. indirect effects

This systematic workflow provides a comprehensive approach to characterizing ZDHHC2 function in new research models.

What are the essential resources for researchers studying ZDHHC2?

Researchers investigating ZDHHC2 should utilize these essential resources:

  • Key antibodies and reagents:

    • Anti-ZDHHC2 antibodies: AP5592a (Abgent) has been validated for immunohistochemistry and Western blotting

    • Expression vectors: GV230 vector with EGFP tag has been used successfully for ZDHHC2 expression

    • Palmitoylation detection reagents: Biotin-HPDP for ABE assays and biotin-alkyne for click chemistry approaches

  • Genetic constructs:

    • ZDHHC2 wild-type expression plasmids with various tags (HA, EGFP)

    • Catalytically inactive ZDHHC2 mutant (C129A) as essential negative control

    • Substrate expression constructs (e.g., AGK wild-type and C72S mutant)

  • Cell lines and models:

    • Renal cancer cell lines: 786-O, A498, and ACHN with established ZDHHC2 expression

    • Hepatocellular carcinoma cell line: Bel-7402 for tumor suppressor studies

    • Sunitinib-resistant cell lines (e.g., 786-O R) for drug resistance studies

  • Bioinformatic resources:

    • The Cancer Genome Atlas (TCGA) for expression data across cancer types

    • CancerSEA (cancer single-cell state atlas) for functional correlation analysis

    • Kyoto Encyclopedia of Genes and Genomes (KEGG) for pathway enrichment

    • Gene Set Enrichment Analysis (GSEA) for transcriptomic data interpretation

  • Methodological protocols:

    • Acyl-biotinyl exchange (ABE) for detecting protein S-palmitoylation

    • Subcellular fractionation techniques for membrane protein isolation

    • Immunohistochemistry scoring systems for ZDHHC2 expression quantification

  • Statistical analysis approaches:

    • Chi-square test or Fisher exact test for categorical comparisons

    • Kaplan-Meier method for survival analysis

    • Cox proportional hazard model for multivariate analysis

    • Independent Student's t-test for comparing continuous variables between groups

These resources provide the essential tools, models, and analytical approaches required for comprehensive investigation of ZDHHC2 biology across diverse research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.