Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity

ZDHHC5 catalyzes palmitoylation of diverse substrates:

  • Furin/PC7: Palmitoylation by ZDHHC5 directs these proteases to plasma membrane microdomains, enabling anthrax toxin activation .

  • SSTR5: Palmitoylation enhances anti-proliferative signaling in pancreatic cancer cells .

  • Phospholemman (PLM): Interaction with the Na⁺/K⁺-ATPase α-subunit facilitates PLM palmitoylation, regulating cardiac ion transport .

  • STAT3, NOD1/NOD2: Modulates inflammatory signaling and pathogen sensing .

Regulatory Mechanisms

  • Autopalmitoylation: Cysteine residues (C236/C237) in ZDHHC5’s cytoplasmic domain undergo autoacylation, influencing enzyme stability and substrate recruitment .

  • Accessory Proteins: Golga7b stabilizes ZDHHC5 at the plasma membrane and promotes interactions with desmosomal proteins, enhancing cell adhesion .

Cancer

  • Pancreatic Cancer: ZDHHC5 knockdown reduces cell proliferation and tumor growth in xenograft models by impairing SSTR5 palmitoylation .

  • Non-Small Cell Lung Cancer: Overexpression drives tumorigenesis and xenograft establishment .

Cardiovascular Disease

  • Heart Failure (HF): ZDHHC5 expression is dysregulated in HF, correlating with altered palmitoylation of cardiac substrates like NCX1 and PLM .

Therapeutic Targeting

  • Lomitapide: An FDA-approved drug repurposed as a ZDHHC5 inhibitor (K<sub>d</sub> = 509 nM) blocks SSTR5 palmitoylation, showing promise in pancreatic cancer .

  • Peptide Inhibitors: Disruption of ZDHHC5-Na⁺/K⁺-ATPase interaction reduces PLM palmitoylation, offering potential for treating arrhythmias .

Technical Considerations

  • Activity Assays: Recombinant ZDHHC5 requires reconstitution into lipid bilayers for functional studies due to its membrane-dependent mechanism .

  • Antibodies: Commercial antibodies (e.g., Proteintech 84803-4-RR) target epitopes between residues 60–148, suitable for Western blotting and immunoprecipitation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ZDHHC5; KIAA1748; ZNF375; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5; Zinc finger protein 375
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSG VRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSS SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI VASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTP KDEVQLKTTYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
Palmitoyltransferase catalyzes the addition of palmitate to various protein substrates and participates in numerous cellular processes. It palmitoylates the G-protein coupled receptor SSTR5 and FLOT2.
Gene References Into Functions
  1. Elevated ZDHHC5 expression is associated with Glioma. PMID: 28775165
  2. Evidence suggests that DHHC5 possesses oncogenic properties and contributes to tumor formation in non-small cell lung cancer. PMID: 25573953
  3. ZDHHC5 and SSTR5 colocalize at the plasma membrane, and coexpression of ZDHHC5 enhances palmitoylation of SSTR5. Conversely, knockdown of endogenous ZDHHC5 by siRNAs reduces palmitoylation. PMID: 21820437
  4. Findings indicate that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 are S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain. PMID: 19801377
Database Links

HGNC: 18472

OMIM: 614586

KEGG: hsa:25921

STRING: 9606.ENSP00000287169

UniGene: Hs.27239

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC5 and what is its primary function?

ZDHHC5 is an enzyme that catalyzes protein S-palmitoylation, a reversible post-translational modification that adds fatty acids to proteins. This modification is characterized by a conserved catalytic domain containing an Asp-His-His-Cys (DHHC) motif. ZDHHC5 plays a crucial role in regulating protein trafficking, stability, and function across diverse cellular processes . Palmitoylation by ZDHHC5 can significantly impact protein half-life, either extending or shortening it depending on the substrate. Research indicates that ZDHHC5 is particularly important in neurological function and cancer progression through its influence on membrane protein localization .

How does ZDHHC5 differ from other palmitoyltransferases?

ZDHHC5 distinguishes itself from other palmitoyltransferases through its specific subcellular localization and substrate preferences. Unlike many DHHC proteins that localize primarily to the Golgi apparatus, ZDHHC5 can dynamically traffic between the plasma membrane and endosomal compartments. Its function can be regulated through interactions with binding partners including Golga7b, Fyn kinase, and PSD-95, which stabilize ZDHHC5 at the membrane by preventing clathrin-mediated endocytosis . This dynamic trafficking enables differential palmitoylation of substrates in response to cellular signals, providing a mechanism for context-dependent regulation not observed with other palmitoyltransferases .

Which protein domains are essential for ZDHHC5 function?

Several domains are critical for ZDHHC5 function:

  • The DHHC catalytic domain: Essential for enzymatic palmitoylation activity

  • Plasma membrane localization sequences: Required for proper subcellular targeting

  • C-terminal domain: Important for protein-protein interactions, including the PDZ-binding motif that enables interactions with PSD-95

Research demonstrates that mutations affecting these domains can significantly impact ZDHHC5 function. Notably, a patient with schizophrenia was found to have a de novo mutation introducing a premature stop codon at residue 648 (E648), resulting in truncation of the last 68 amino acids of ZDHHC5, including the PDZ-binding motif . This suggests the C-terminal domain is particularly important for ZDHHC5's neurological functions.

What are the most effective methods for detecting ZDHHC5-mediated protein palmitoylation?

Several complementary approaches can be used to detect and quantify ZDHHC5-mediated palmitoylation:

  • Acyl-biotin exchange (ABE) assay: This method involves replacing palmitoyl modifications with biotin, followed by streptavidin pull-down and identification of palmitoylated proteins by mass spectrometry.

  • Metabolic labeling with palmitate analogs: Using clickable palmitate analogs like 17-octadecynoic acid (17-ODYA) that can be conjugated to reporter molecules after incorporation into proteins.

  • Mass spectrometry-based approaches: SILAC (stable isotope labeling with amino acids in cell culture) can be used to quantitatively measure differences in protein amounts between control and ZDHHC5-knockout cells .

For comprehensive analysis, researchers should combine these approaches with validation experiments such as site-directed mutagenesis of putative palmitoylation sites and functional assays to determine the physiological relevance of palmitoylation events.

How can I effectively silence or knockout ZDHHC5 in experimental models?

Multiple approaches have been successfully employed to modulate ZDHHC5 expression:

  • siRNA-mediated knockdown: Used successfully in cancer cell lines (Panc-1 and Mia PaCa-2) with significant reduction in ZDHHC5 expression and corresponding functional effects on cell proliferation .

  • CRISPR/Cas9-mediated gene editing: Employed to generate complete ZDHHC5 knockout cells, as demonstrated in RPE-1 cells . This approach allows for stable loss of ZDHHC5 expression and comprehensive analysis of phenotypic consequences.

  • Stable shRNA expression: Used to create stable ZDHHC5-knockdown cell lines for long-term experiments, including in vivo xenograft studies .

When studying ZDHHC5 function, it's important to validate knockdown/knockout efficiency at both mRNA level (using RT-qPCR) and protein level (using Western blotting) as demonstrated in multiple studies .

What cell-based assays are most informative for studying ZDHHC5 function?

Several key assays provide valuable insights into ZDHHC5 function:

  • Proliferation assays: Cell counting kit-8 (CCK-8) assays or similar methods have revealed that ZDHHC5 knockdown significantly decreases proliferation in cancer cell lines .

  • Surface biotinylation and proteomics: Biotinylation of cell surface proteins followed by isolation and mass spectrometry analysis can identify surface proteins affected by ZDHHC5 .

  • Flow cytometry: For quantitative analysis of cellular phenotypes and protein expression changes dependent on ZDHHC5 .

  • Immunofluorescence microscopy: Particularly useful for studying ZDHHC5's role in synaptic formation, using markers like PSD-95 (for excitatory synapses) and gephyrin (for inhibitory synapses) .

  • Electrophysiology: In neuronal systems, patch-clamp recordings can assess the functional consequences of ZDHHC5 manipulation on synaptic transmission .

How does ZDHHC5 contribute to cancer cell proliferation and tumor growth?

ZDHHC5 plays a significant role in promoting cancer cell proliferation through several mechanisms:

  • Enhanced palmitoylation of growth-promoting proteins: ZDHHC5 mediates palmitoylation of membrane proteins that regulate downstream signaling pathways, including Akt, c-Raf, MEK, and ERK pathways .

  • Regulation of tumor suppressor function: In glioma, ZDHHC5 has been shown to alter the palmitoylation and phosphorylation status of tumor suppressor EZH2, contributing to the self-renewal capacity and tumorigenicity of glioma stem-like cells .

  • Differential expression in cancer cells: ZDHHC5 expression is significantly higher in cancer cells compared to normal cells (such as HPDE pancreatic cells), suggesting a cancer-specific role .

In vivo xenograft experiments have demonstrated that ZDHHC5-knockdown tumors exhibit substantially reduced tumor weight and volume compared to control tumors, with corresponding decreases in proliferation markers like Ki67 . This demonstrates ZDHHC5's critical role in supporting tumor growth.

What is the relationship between ZDHHC5 and mutant p53 in cancer?

The relationship between ZDHHC5 and mutant p53 represents an important axis in cancer biology:

  • Transcriptional upregulation: Mutant p53 transcriptionally upregulates ZDHHC5 expression along with the nuclear transcription factor NF-Y in glioma .

  • Clinical correlation: ZDHHC5 overexpression tightly correlates with p53 mutations in glioma specimens .

  • Functional consequence: This relationship contributes to glioma progression by promoting the self-renewal capacity and tumorigenicity of glioma stem-like cells through altered palmitoylation and phosphorylation of tumor suppressor proteins .

This relationship is particularly significant given that p53 mutations occur in approximately 30% of glioma cases and are associated with therapeutic resistance and poor outcomes. The ZDHHC5-mutant p53 axis represents a potential therapeutic vulnerability in these aggressive tumors .

Can ZDHHC5 serve as a therapeutic target in cancer treatment?

ZDHHC5 shows considerable promise as a therapeutic target in cancer:

  • Drug repositioning approach: Research has identified Lomitapide, an FDA-approved drug, as the first small molecule antagonist of ZDHHC5 with a strong binding affinity (Kd = 509 nM) . Molecular docking identified Lomitapide's binding pocket on ZDHHC5's substrate binding domain, consisting of His132, CYS134, PRO135, TRP136, PHE196, PRO199, LEU203, PHE206 and THR217 .

  • Preclinical evidence of efficacy: Pharmacological blockade of ZDHHC5 with Lomitapide resulted in attenuated cancer cell growth and proliferation, with significant anti-tumor responses both in vitro and in mouse models in vivo .

  • Selective targeting potential: The differential expression of ZDHHC5 between cancer cells and normal cells suggests potential for selective targeting with minimal toxicity to normal tissues .

This approach of repurposing existing drugs that can inhibit ZDHHC5 represents an efficient drug development strategy that may accelerate translation to clinical applications.

How does ZDHHC5 regulate synaptic function in the brain?

ZDHHC5 serves as a critical regulator of synaptic function through multiple mechanisms:

  • Excitatory synapse formation: ZDHHC5 is essential for the formation and/or maintenance of excitatory synapses, but not inhibitory synapses, both in vitro and in vivo .

  • Activity-dependent regulation: The dynamic trafficking of ZDHHC5 enables differential palmitoylation of its substrates in response to neuronal activity, providing a mechanism for activity-dependent synaptic plasticity .

  • Structural requirements: Proper synaptic function depends on ZDHHC5's enzymatic activity, its localization at the plasma membrane, and its C-terminal domain (which contains a PDZ-binding motif that enables interactions with PSD-95) .

What is the relationship between ZDHHC5 and neuropsychiatric disorders?

Several lines of evidence connect ZDHHC5 dysfunction to neuropsychiatric disorders:

  • Genetic evidence: A de novo mutation in ZDHHC5 has been reported in a patient with schizophrenia. This mutation introduces a premature stop codon at residue 648 (E648), resulting in truncation of the last 68 amino acids of ZDHHC5, including the PDZ-binding motif essential for interactions with synaptic proteins .

  • Mechanistic basis: ZDHHC5's role in regulating excitatory synapses provides a potential mechanistic explanation for its involvement in neuropsychiatric disorders, which often feature abnormalities in synaptic connectivity and function .

  • Broader context: Abnormalities in DHHC proteins and protein palmitoylation have been implicated in various neurological disorders including schizophrenia, X-linked mental retardation, and Huntington's disease .

These findings suggest that dysfunction of ZDHHC5-mediated palmitoylation may contribute to the synaptic abnormalities observed in schizophrenia and potentially other neuropsychiatric disorders, highlighting ZDHHC5 as a relevant target for understanding disease mechanisms.

How do substrate specificity and subcellular localization of ZDHHC5 influence its function?

ZDHHC5's substrate specificity and subcellular localization are intricately linked aspects that determine its functional outcomes:

  • Subcellular targeting mechanism: ZDHHC5 can be stabilized at the synaptic membrane through its association with accessory proteins including Golga7b and Fyn kinase, which inhibit ZDHHC5-AP2μ interactions and clathrin-mediated endocytosis . Additionally, binding to PSD-95 via its C-terminal PDZ-binding domain further stabilizes ZDHHC5 at the membrane .

  • Dynamic regulation: ZDHHC5 localization can be dynamically regulated in response to external cues, allowing it to palmitoylate different substrates based on cellular context and signaling state .

  • Compartmentalized activity: By localizing to different subcellular domains, ZDHHC5 can regulate distinct pools of substrates. This compartmentalization enables precise spatial control of protein palmitoylation, contributing to the specificity of ZDHHC5's effects .

This interplay between localization and substrate access explains how ZDHHC5 can have such diverse functions in different cellular contexts, from cancer cells to neurons, by palmitoylating cell type-specific substrates.

What are the molecular mechanisms by which ZDHHC5 inhibition affects different cellular processes?

The molecular consequences of ZDHHC5 inhibition are multifaceted and context-dependent:

  • Effects on protein stability: Mass spectrometry analysis of ZDHHC5-knockout cells revealed that palmitoylated proteins were significantly less abundant compared to control cells, suggesting that in the absence of ZDHHC5, these proteins had reduced half-lives . This indicates that ZDHHC5-mediated palmitoylation is often protective against protein degradation.

  • Alterations in cell surface proteome: ZDHHC5 knockout affected cell surface protein abundance even for proteins not directly palmitoylated by ZDHHC5, suggesting indirect effects through alterations in the endocytic pathway .

  • Signaling pathway disruption: In cancer cells, ZDHHC5 inhibition disrupts key signaling pathways including Akt, c-Raf, MEK, and ERK, which are critical for cell proliferation and survival . This occurs through altered palmitoylation of upstream membrane proteins like somatostatin receptor 5 (SSTR5) .

  • Protein compartmentalization changes: In toxin research, ZDHHC5 has been shown to affect the partitioning of proteins into microdomains on the cell surface rather than affecting their enzymatic activity directly . This highlights how ZDHHC5 inhibition can reorganize the spatial arrangement of proteins without necessarily altering their intrinsic functions.

Understanding these diverse mechanisms is crucial for interpreting the effects of ZDHHC5-targeting therapeutics and for designing context-appropriate interventions.

How can contradictory data on ZDHHC5 function across different disease models be reconciled?

Reconciling seemingly contradictory data on ZDHHC5 function requires consideration of several factors:

  • Cell type-specific substrate profiles: ZDHHC5 may palmitoylate different substrates in different cell types, leading to distinct functional outcomes. Comprehensive palmitoyl-proteomics in each model system can help identify cell type-specific ZDHHC5 substrates .

  • Context-dependent signaling effects: The same molecular event (e.g., palmitoylation of a specific protein) may have different downstream consequences depending on the cellular signaling environment. For example, in cancer cells, ZDHHC5 promotes proliferation , while in neurons it regulates synapse formation .

  • Compensatory mechanisms: Long-term loss of ZDHHC5 may trigger compensatory upregulation of other DHHC family members with partially overlapping substrate specificity. Short-term (acute) versus long-term (chronic) inhibition studies can help distinguish primary ZDHHC5 functions from adaptive responses.

  • Methodological differences: Variations in experimental approaches (genetic knockout vs. knockdown vs. pharmacological inhibition) may yield different results. Comparative studies using multiple approaches in the same model system are valuable for resolving such discrepancies.

Systematic investigation of these factors across different disease models can help develop a unified understanding of ZDHHC5 biology and more accurately predict the outcomes of therapeutic interventions targeting this enzyme.

What controls are essential when studying ZDHHC5 function in experimental models?

Rigorous experimental design for ZDHHC5 studies requires several critical controls:

  • Enzyme activity controls: Include catalytically inactive ZDHHC5 mutants (e.g., DHHC to DHHS mutations) to distinguish enzymatic from scaffolding functions.

  • Expression level validation: Quantify ZDHHC5 knockdown/knockout efficiency at both mRNA (RT-qPCR) and protein (Western blot) levels .

  • Rescue experiments: Reintroduction of wild-type or mutant ZDHHC5 into knockout cells to confirm specificity of observed phenotypes and identify essential domains.

  • Off-target effect controls: For siRNA studies, include multiple siRNA sequences and non-targeting controls; for CRISPR, include multiple guide RNAs and off-target analysis.

  • Cell type-specific controls: When comparing ZDHHC5 function across cell types, account for differences in baseline expression levels, which can vary significantly between cancer cells and normal cells .

Implementation of these controls helps ensure the reliability and interpretability of experimental findings related to ZDHHC5 function.

How can researchers overcome challenges in expressing and purifying recombinant ZDHHC5?

Producing functional recombinant ZDHHC5 presents several challenges that can be addressed through specialized approaches:

  • Expression systems: Mammalian expression systems (HEK293, CHO) often yield more properly folded and functional ZDHHC5 than bacterial systems due to appropriate post-translational modifications and membrane insertion.

  • Construct design: Consider expressing functional domains separately rather than the full-length protein. The substrate binding domain of ZDHHC5 has been successfully expressed and used for binding studies with potential inhibitors .

  • Solubilization strategies: Use appropriate detergents (e.g., DDM, CHAPS) or nanodiscs to maintain the native conformation of this multi-pass membrane protein during purification.

  • Stability enhancement: Include stabilizing agents such as cholesterol or specific lipids in purification buffers to maintain ZDHHC5 in an active conformation.

  • Activity verification: Implement in vitro palmitoylation assays using known substrates to confirm that the purified protein retains enzymatic activity.

These strategies can help overcome the inherent challenges of working with membrane-bound enzymes like ZDHHC5 and facilitate structural and biochemical studies.

What are the best approaches for screening potential ZDHHC5 inhibitors?

Effective screening approaches for ZDHHC5 inhibitors include:

  • Structure-based virtual screening: Molecular docking of compound libraries to the 3D model of ZDHHC5's substrate binding domain, as successfully demonstrated with FDA-approved drugs . The binding pocket consisting of His132, CYS134, PRO135, TRP136, PHE196, PRO199, LEU203, PHE206, and THR217 has been identified as a promising target site .

  • Binding affinity assays: Measurement of direct binding between compounds and purified ZDHHC5 using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine Kd values .

  • Cellular activity assays: Validation of hit compounds in cell-based assays monitoring:

    • Palmitoylation status of known ZDHHC5 substrates

    • Functional endpoints such as cancer cell proliferation

    • Phenotypic rescue experiments in ZDHHC5 knockout cells

  • Selectivity profiling: Assessment of inhibitor specificity across the DHHC family by testing activity against multiple DHHC enzymes to identify ZDHHC5-selective compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.