Recombinant Human Palmitoyltransferase ZDHHC7 (ZDHHC7)

Shipped with Ice Packs
In Stock

Description

Overview of ZDHHC7

ZDHHC7 belongs to the zinc finger DHHC-type palmitoyltransferase family, which catalyzes the addition of palmitate groups to cysteine residues of target proteins. This modification regulates protein-membrane interactions, trafficking, and downstream signaling pathways . Recombinant ZDHHC7 is synthesized using in vitro expression systems (e.g., E. coli) to enable high-purity studies of its enzymatic activity .

Table 1: Production Details of Recombinant ZDHHC7

ParameterDetail
Expression SystemE. coli (in vitro)
Purity>90% (verified by SDS-PAGE)
Molecular Weight~34 kDa (predicted)
ApplicationsEnzyme activity assays, protein interaction studies, drug screening
StorageLyophilized at -80°C for long-term stability

Source: Cusabio Product Documentation

Role in Disease Pathogenesis

  • Prostate Cancer: ZDHHC7-mediated palmitoylation of Scribble (SCRIB) maintains cell polarity and suppresses metastasis. Loss of ZDHHC7 disrupts SCRIB localization, activating oncogenic pathways like YAP and MAPK .

  • Alzheimer’s Disease (AD): ZDHHC7 overexpression in AD brains correlates with hyperpalmitoylation of synaptic proteins (e.g., BACE1, SNAP25), exacerbating Aβ deposition and cognitive decline .

  • Inflammasome Activation: ZDHHC7 palmitoylates NLRP3 at Cys126, promoting inflammasome assembly and IL-1β secretion in macrophages .

Functional Mechanisms

  • Subcellular Localization: ZDHHC7 regulates NLRP3 localization on the trans-Golgi network (TGN), facilitating ASC oligomerization during inflammasome activation .

  • Epigenetic Regulation: Brain insulin resistance in AD models upregulates ZDHHC7 via FoxO1, linking metabolic dysfunction to protein hyperpalmitoylation .

Table 2: Key Targets of ZDHHC7

Target ProteinFunctionDisease RelevanceSource
SCRIBCell polarity, tumor suppressionProstate cancer metastasis
NLRP3Inflammasome activationInflammatory diseases
BACE1Aβ productionAlzheimer’s disease
ERα/ERβEstrogen signalingBreast cancer progression

Therapeutic Implications

  • Inhibition Strategies:

    • Pharmacological inhibitors (e.g., 2-bromopalmitate) reduce ZDHHC7 activity, ameliorating neuroinflammation in AD models .

    • CRISPR-mediated ZDHHC7 knockout suppresses NLRP3 inflammasome activation and prostate cancer cell invasion .

  • Biomarker Potential: Elevated ZDHHC7 expression in metastatic prostate cancer and AD patient tissues highlights its diagnostic utility .

Challenges and Future Directions

  • Technical Limitations: Antibody specificity issues complicate ZDHHC7 detection in cellular assays .

  • Therapeutic Complexity: ZDHHC7 has dual roles (e.g., tumor suppression in prostate cancer vs. pro-inflammatory effects in macrophages), necessitating context-specific targeting .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC7; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; Zinc finger DHHC domain-containing protein 7; DHHC-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC7
Target Protein Sequence
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAY ADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM YIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGT QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPR KGGPEFSV
Uniprot No.

Target Background

Function
ZDHHC7 is a Golgi-localized palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates. This activity plays a role in a range of biological processes. ZDHHC7 exhibits broad fatty acid selectivity and can transfer myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA onto target proteins, in addition to palmitate. It palmitoylates sex steroid hormone receptors, including ESR1, PGR, and AR, influencing their membrane targeting and function in rapid intracellular signaling upon sex hormone binding. ZDHHC7 palmitoylates GNAQ, a heterotrimeric G protein, regulating its dynamic localization at the plasma membrane and participating in GNAQ-dependent G protein-coupled receptor signaling pathways. It also contributes to ligand-induced cell death by regulating the FAS signaling pathway through the palmitoylation and stabilization of the receptor at the plasma membrane. In epithelial cells, ZDHHC7 palmitoylates SCRIB, regulating its localization to the plasma membrane, indirectly influencing cell polarity and differentiation. It also palmitoylates JAM3, promoting its expression at tight junctions and regulating its function in cell migration. ZDHHC7 palmitoylates the glucose transporter GLUT4/SLC2A4, controlling the insulin-dependent translocation of GLUT4 to the plasma membrane. In the brain, ZDHHC7 may also palmitoylate SNAP25 and DLG4/PSD95. It may also palmitoylate DNAJC5, regulating its localization to the Golgi membrane, and potentially palmitoylates NCDN. ZDHHC7 may play a role in follicle-stimulating hormone (FSH) activation of testicular Sertoli cells.
Gene References Into Functions
  1. identified DHHC7 as a JAM-C palmitoylating enzyme PMID: 28196865
  2. ZDHHC7-mediated SCRIB palmitoylation is critical for SCRIB membrane targeting, cell polarity and tumor suppression, providing new mechanistic insights into how dynamic protein palmitoylation regulates cell polarity and tumorigenesis. PMID: 27380321
  3. DHHC7-mediated palmitoylation of Fas allows a proper Fas expression level by preventing its degradation through the lysosomes. PMID: 25301068
  4. DHHC-7 and -21 proteins are novel targets to selectively inhibit membrane sex steroid receptor localization and function PMID: 22031296
Database Links

HGNC: 18459

OMIM: 614604

KEGG: hsa:55625

UniGene: Hs.461610

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC7 and what is its primary function?

ZDHHC7 belongs to the zinc finger DHHC domain-containing (ZDHHC) family of palmitoyltransferases that catalyze the addition of palmitate to specific cysteine residues of target proteins. The enzyme contains a conserved DHHC motif within its catalytic domain that is essential for its palmitoyltransferase activity, as demonstrated by the inability of the enzymatically inactive mutant (ZDHHS7) to restore NLRP3 palmitoylation in ZDHHC7-deleted cells . Unlike some other ZDHHC family members, ZDHHC7 shows a relatively high expression level in macrophages and monocytes, suggesting its specialized role in immune cells . The primary function of ZDHHC7 is to mediate S-palmitoylation—a reversible post-translational modification that increases protein hydrophobicity and facilitates membrane association of otherwise soluble proteins . This modification significantly impacts protein-protein interactions, subcellular localization, and ultimately signal transduction pathways across multiple cellular contexts .

How is ZDHHC7 expression regulated in different tissues and disease states?

ZDHHC7 expression varies significantly across different tissue types, with predominant expression observed in immune cells, particularly in human CD14 high CD16− classical monocytes and bone marrow-derived macrophages (BMDMs) . Analysis of gene expression databases has revealed that ZDHHC7 shows distinctively high expression compared to other ZDHHC family members in these cell types, suggesting tissue-specific regulatory mechanisms . In pathological conditions such as Alzheimer's disease (AD), ZDHHC7 expression is significantly increased in hippocampal tissues, as observed in both 3×Tg-AD mice and post-mortem AD patient samples . This aberrant expression appears to be mediated through a FoxO1-dependent epigenetic mechanism triggered by brain insulin resistance (BIR) . Conversely, in prostate cancer progression models, ZDHHC7 levels may be altered as it potentially functions as a tumor suppressor, though the exact regulatory mechanisms in this context require further investigation . The differential expression of ZDHHC7 across tissues and its dysregulation in disease states highlight its context-dependent roles and the complex regulatory networks controlling its expression.

How does ZDHHC7-mediated palmitoylation affect NLRP3 inflammasome activation?

ZDHHC7 specifically catalyzes the S-palmitoylation of NLRP3 at Cysteine 126 (Cys126), which serves as a critical regulatory mechanism for proper inflammasome assembly and activation in macrophages . This modification profoundly influences the subcellular localization of NLRP3, promoting its association with the trans-Golgi network (TGN) in the resting state and facilitating its localization to the dispersed TGN upon activation . Experimental evidence from co-immunoprecipitation and fluorescence resonance energy transfer (FRET) assays confirms that ZDHHC7 physically interacts with NLRP3 in macrophages, providing the molecular basis for this site-specific modification . The functional significance of this interaction has been validated through multiple approaches, including ZDHHC7 knockout studies in both mouse BMDMs and human THP-1 cells, where NLRP3 palmitoylation was dramatically diminished . Mechanistically, ZDHHC7-mediated NLRP3 palmitoylation is specifically required for the recruitment and oligomerization of the adaptor ASC (apoptosis-associated speck-like protein containing a CARD), which is indispensable for downstream inflammasome assembly . Perturbing this palmitoylation through genetic deletion of ZDHHC7 or pharmacological inhibition significantly reduces caspase-1 activation, GSDMD cleavage, and IL-1β secretion in response to NLRP3 activators, confirming its essential role in the activation step rather than the priming phase of inflammasome activation .

What methodologies are used to detect and quantify ZDHHC7-mediated protein palmitoylation?

Researchers employ several sophisticated techniques to detect and quantify ZDHHC7-mediated protein palmitoylation in experimental systems. The Alk14 metabolic labeling approach has emerged as a powerful method, wherein cells are incubated with ω-alkynyl palmitic acid (Alk14), which is incorporated into palmitoylated proteins, followed by click chemistry-mediated conjugation of detection tags like biotin-azide . This technique allows for specific detection and enrichment of palmitoylated proteins via streptavidin pulldown and subsequent western blot analysis, as demonstrated in studies of NLRP3 palmitoylation in both mouse BMDMs and human THP-1 cells . Another widely used approach involves the acyl-biotin exchange (ABE) method, where free thiols are first blocked, followed by hydroxylamine treatment to specifically cleave thioester bonds of palmitoylated cysteines, creating new thiols that can be labeled with biotin for detection . The specificity of palmitoylation can be confirmed using hydroxylamine sensitivity tests, as authentic S-palmitoylation is abolished by hydroxylamine treatment, which was utilized to verify ZDHHC7-mediated NLRP3 palmitoylation . For studying inhibitor binding and specificity, specialized probes such as 2-BP-Alk (2-bromopalmitate alkyne) can be synthesized to identify proteins targeted by palmitoylation inhibitors through similar click chemistry-based approaches, thereby providing insights into mechanisms of pharmacological intervention .

How can researchers experimentally manipulate ZDHHC7 activity in cellular and animal models?

Researchers have developed multiple complementary approaches to manipulate ZDHHC7 activity across various experimental systems. Genetic approaches include the generation of ZDHHC7 knockout mice, which provide valuable tools for studying the physiological roles of ZDHHC7-mediated palmitoylation in primary cells like bone marrow-derived macrophages (BMDMs) . For human cell lines, CRISPR/Cas9-mediated knockout systems have been successfully employed to create ZDHHC7-deficient THP-1 cells, enabling comparative studies between mouse and human macrophage models . Alongside complete gene deletion, the expression of enzymatically inactive ZDHHC7 mutants (ZDHHS7) serves as an important control to differentiate between scaffolding functions and catalytic activity of the protein . For acute inhibition of palmitoyltransferase activity, pharmacological agents such as 2-bromopalmitate (2-BP) and MY-D4 have proven effective in suppressing ZDHHC7-mediated protein palmitoylation in both cellular and animal models . In vivo manipulation strategies include chronic intranasal administration of 2-BP in mouse models of Alzheimer's disease, which successfully counteracted synaptic plasticity deficits, reduced amyloid-β deposition, and extended lifespan in 3×Tg-AD mice . For targeted manipulation in specific brain regions, hippocampal silencing of ZDHHC7 through stereotactic injection of viral vectors carrying shRNA has been demonstrated to prevent cognitive deficits in neurodegenerative disease models .

What is the role of ZDHHC7 in neurodegenerative disorders?

ZDHHC7 plays a significant role in neurodegenerative disorders, particularly in Alzheimer's disease (AD), where aberrant protein S-palmitoylation contributes to synaptic dysfunction and cognitive decline . Research has identified increased expression of ZDHHC7 and elevated protein S-palmitoylation in hippocampal tissues from both 3×Tg-AD mice and post-mortem AD patient samples, establishing a direct correlation between ZDHHC7 activity and disease pathology . This upregulation appears to be mediated through a FoxO1-dependent epigenetic mechanism triggered by brain insulin resistance (BIR), highlighting the complex interplay between metabolic dysfunction and neurodegeneration that has led some researchers to refer to AD as "type III diabetes" . Functionally, ZDHHC7-mediated palmitoylation affects both synaptic plasticity proteins and those involved in amyloid-β (Aβ) metabolism, directly impacting the two major hallmarks of AD pathology . The causal relationship between ZDHHC7 hyperactivity and cognitive decline has been firmly established through intervention studies, where hippocampal silencing of ZDHHC7 prevented the onset of cognitive deficits in AD mouse models .

How does ZDHHC7-mediated Scribble palmitoylation impact cell polarity and cancer progression?

ZDHHC7-mediated palmitoylation of Scribble, a critical cell polarity regulator, plays an essential role in maintaining proper tissue organization and preventing uncontrolled cell proliferation and migration . In the context of prostate cancer, loss of ZDHHC7 expression leads to disruption of Scribble palmitoylation, resulting in its mislocalization within cancer cells . This mislocalization directly impacts cell polarity maintenance, as properly palmitoylated Scribble must be correctly positioned at specific membrane domains to perform its tumor-suppressive functions . Research indicates that ZDHHC7 itself may function as a tumor suppressor in prostate cancer cells, restricting the activity of downstream oncogenic factors through its palmitoylation activity . Experimental approaches to investigate this mechanism include analyzing the palmitoylation levels of Scribble in various prostate cancer cell lines at different progression stages and correlating these levels with Scribble localization patterns . The functional significance of this pathway in cancer progression is being evaluated through both in vitro cellular models and in vivo preclinical studies, with the ultimate goal of validating ZDHHC7 and its substrates as potential therapeutic targets for prostate cancer treatment .

What are the known inhibitors of ZDHHC7 and their potential therapeutic applications?

Several small molecule inhibitors of protein S-palmitoylation have been identified and characterized for their effects on ZDHHC7 activity and potential therapeutic applications. The most widely studied inhibitor is 2-bromopalmitate (2-BP), a non-selective palmitoyltransferase inhibitor that has shown efficacy in suppressing ZDHHC7-mediated protein palmitoylation in multiple experimental systems . Using specialized 2-BP-Alk probes, researchers have confirmed direct binding of 2-BP to ZDHHC7 in activated macrophages, providing evidence for its mechanism of action . In neurodegenerative disease models, chronic intranasal administration of 2-BP has demonstrated remarkable therapeutic potential, counteracting synaptic plasticity and cognitive deficits, reducing amyloid-β deposition in the hippocampus, and significantly extending the lifespan of both male and female 3×Tg-AD mice . Another inhibitor, MY-D4, has also shown potent inhibition of NLRP3 inflammasome activation in THP-1 cells, as evidenced by suppressed GSDMD cleavage and IL-1β secretion . The specificity of these inhibitors for ZDHHC7 over other palmitoyltransferases has been partially addressed through comparative studies in ZDHHC7 knockout cells, where 2-BP treatment did not further suppress inflammasome activation, suggesting that its effects are primarily mediated through ZDHHC7 inhibition . These findings collectively support the therapeutic potential of targeting ZDHHC7 with specific inhibitors for treating inflammatory disorders, neurodegenerative diseases, and potentially certain types of cancer where aberrant protein palmitoylation contributes to disease pathology.

How can recombinant ZDHHC7 be produced and purified for in vitro studies?

Production of functionally active recombinant human ZDHHC7 presents several technical challenges due to its multi-pass transmembrane structure and requirement for proper folding within membrane environments. Researchers typically employ mammalian expression systems such as HEK293T cells transfected with epitope-tagged ZDHHC7 constructs to ensure proper post-translational modifications and folding . For purification strategies, detergent-based membrane protein extraction using mild non-ionic detergents such as digitonin or n-dodecyl-β-D-maltoside (DDM) helps maintain protein structure and activity during solubilization from cellular membranes. Affinity chromatography using tags such as FLAG, HA, or His6 allows for selective purification, often followed by size exclusion chromatography to achieve higher purity and remove aggregates. The enzymatic activity of purified recombinant ZDHHC7 can be verified through in vitro palmitoylation assays using purified substrate proteins like NLRP3 and 14C-labeled palmitoyl-CoA or bioorthogonal alkyne-modified palmitoyl-CoA analogues . When expressing recombinant ZDHHC7 in heterologous systems, researchers must consider that the enzymatically inactive mutant (ZDHHS7) serves as an essential negative control to distinguish between specific palmitoyltransferase activity and non-specific effects . For structural and functional studies, reconstitution of purified ZDHHC7 into artificial membrane systems such as nanodiscs or liposomes may help maintain its native conformation and catalytic activity.

What techniques are used to identify novel ZDHHC7 substrate proteins?

Identifying novel ZDHHC7 substrate proteins requires complementary approaches that combine unbiased screening methods with targeted validation techniques. Proteomics-based methodologies serve as powerful initial screening tools, where comparative palmitoyl-proteomics between wild-type and ZDHHC7-deficient cells can reveal potential substrates . This approach typically involves metabolic labeling with alkyne-palmitate analogues (Alk14), click chemistry-mediated biotinylation, streptavidin enrichment, and mass spectrometry analysis to identify differentially palmitoylated proteins . Candidate ZDHHC7 substrates identified through proteomics should be validated using orthogonal techniques such as acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC) methods, which specifically detect S-palmitoylated proteins through hydroxylamine-sensitive thioester bonds . Direct interaction between ZDHHC7 and potential substrates can be confirmed using co-immunoprecipitation assays, as demonstrated for NLRP3, or through more sophisticated approaches like proximity labeling (BioID or APEX) coupled with mass spectrometry . The functional significance of ZDHHC7-mediated palmitoylation on candidate substrates should be assessed through mutagenesis of predicted palmitoylation sites, as exemplified by the Cys126 mutation in NLRP3, followed by functional assays relevant to the substrate's biological role . For spatial context, fluorescence microscopy techniques such as co-localization studies or fluorescence resonance energy transfer (FRET) can provide valuable insights into the subcellular compartments where ZDHHC7 interacts with its substrates, as shown for NLRP3 co-localization with ZDHHC7 in macrophages .

What are the potential applications of ZDHHC7 inhibitors in inflammatory and neurodegenerative diseases?

The therapeutic potential of ZDHHC7 inhibitors spans multiple disease categories with significant unmet medical needs, particularly inflammatory disorders and neurodegenerative conditions. In inflammatory diseases driven by NLRP3 inflammasome hyperactivation, such as atherosclerosis, type 2 diabetes, and certain autoimmune conditions, selective ZDHHC7 inhibition represents a promising therapeutic strategy by targeting the specific palmitoylation of NLRP3 at Cys126, thereby preventing inflammasome assembly and subsequent inflammatory cascades . Preclinical evidence supports this approach, as both genetic deletion and pharmacological inhibition of ZDHHC7 significantly reduced inflammasome activation in macrophages without affecting the priming step, suggesting potential for therapeutic intervention with limited off-target effects . In neurodegenerative disorders, particularly Alzheimer's disease, the therapeutic efficacy of ZDHHC7 inhibition has been more extensively validated in animal models, where chronic intranasal administration of the palmitoyltransferase inhibitor 2-bromopalmitate not only counteracted synaptic plasticity and cognitive deficits but also reduced amyloid-β deposition and extended lifespan in 3×Tg-AD mice . The development of more selective ZDHHC7 inhibitors beyond the currently available non-specific agents like 2-BP and MY-D4 would significantly advance therapeutic applications by minimizing off-target effects on other palmitoyltransferases or cellular processes . Structure-based drug design approaches targeting the unique features of ZDHHC7's catalytic domain could accelerate the discovery of such selective inhibitors, potentially transforming treatment paradigms for these challenging disease categories.

How might ZDHHC7 research contribute to understanding cancer cell biology and potential therapeutics?

ZDHHC7 research offers significant insights into fundamental aspects of cancer cell biology, particularly regarding cell polarity maintenance and its disruption during malignant transformation. The emerging role of ZDHHC7 as a potential tumor suppressor in prostate cancer highlights its importance in preventing uncontrolled proliferation and metastasis through proper palmitoylation of key substrates like Scribble . Investigation of ZDHHC7 expression patterns across different cancer types and correlation with clinical outcomes could identify specific malignancies where ZDHHC7 dysfunction contributes significantly to disease progression, potentially revealing new therapeutic opportunities. The mechanistic understanding of how ZDHHC7-mediated palmitoylation affects protein localization and function in cancer cells can illuminate broader principles of post-translational regulation in oncogenesis, extending beyond the specific examples currently documented . Future research directions should include comprehensive identification of ZDHHC7 substrates in cancer-relevant pathways, exploration of potential genetic alterations affecting ZDHHC7 function across cancer types, and development of therapeutic strategies to restore proper protein palmitoylation in malignant cells . The use of advanced technologies such as patient-derived organoids, high-content imaging platforms, and CRISPR-based functional genomics will accelerate discovery in this area, potentially positioning ZDHHC7 modulation as a novel approach for cancer treatment, particularly in cases where conventional therapies have limited efficacy .

What novel technologies are emerging for studying protein palmitoylation dynamics?

The study of protein palmitoylation dynamics is being revolutionized by emerging technologies that enable temporal and spatial resolution previously unattainable with conventional methods. Real-time visualization of protein palmitoylation in living cells has become possible through the development of fluorescent palmitate analogues and biosensors that undergo changes in fluorescence properties upon incorporation into target proteins. These approaches allow researchers to track the kinetics of ZDHHC7-mediated palmitoylation and depalmitoylation events with subcellular resolution, providing insights into the dynamic regulation of this modification during cellular processes and signaling events . Advanced mass spectrometry techniques combined with stable isotope labeling are enhancing quantitative analysis of palmitoylation stoichiometry and turnover rates, allowing researchers to determine what fraction of a given protein is palmitoylated and how rapidly this modification changes in response to cellular stimuli . Site-specific incorporation of photo-caged or photo-switchable palmitate analogues through genetic code expansion technologies enables precise temporal control over protein palmitoylation status, facilitating mechanistic studies of how this modification affects protein function in real-time. The integration of palmitoylation studies with cryo-electron microscopy and other structural biology approaches promises to reveal how this lipid modification alters protein conformation and interactions at atomic resolution. The application of these cutting-edge technologies to ZDHHC7 research will significantly advance our understanding of how this enzyme contributes to diverse cellular processes through dynamic regulation of substrate palmitoylation, potentially uncovering new therapeutic targets and intervention strategies for diseases characterized by dysregulated protein lipidation.

What factors affect the reproducibility of ZDHHC7 enzymatic activity assays?

Several critical factors influence the reproducibility of ZDHHC7 enzymatic activity assays, requiring careful consideration during experimental design and execution. The membrane environment is particularly crucial, as ZDHHC7 is a multi-pass transmembrane protein whose activity depends on proper insertion and folding within lipid bilayers . Variations in membrane composition, including cholesterol content and phospholipid species, can significantly affect enzyme conformation and substrate accessibility, necessitating standardized membrane preparations or reconstitution systems for consistent results. The redox state of the reaction environment also impacts assay reproducibility, as the catalytic DHHC domain contains zinc-coordinating cysteine residues that are sensitive to oxidation, potentially leading to irreversible inactivation under non-reducing conditions . Substrate presentation plays an equally important role, as palmitoylation targets must be properly folded and accessible, with potential pre-existing modifications (such as phosphorylation) that might influence ZDHHC7 recognition and catalytic efficiency . Technical variables including detergent selection for protein extraction, palmitoyl-CoA quality and concentration, and detection method sensitivity (whether radioactive, click chemistry-based, or antibody-dependent) can introduce significant variability between laboratories . For cell-based assays, factors such as cell confluence, passage number, and activation state (particularly relevant for immune cells) should be standardized, as these parameters can affect both ZDHHC7 expression levels and substrate availability .

How can researchers optimize ZDHHC7 expression and function in different experimental systems?

Optimizing ZDHHC7 expression and function across experimental systems requires tailored approaches that address the unique challenges of studying this multi-pass transmembrane enzyme. For mammalian expression systems, codon optimization of the ZDHHC7 sequence for the host cell line and careful selection of promoters can significantly improve expression levels while maintaining physiological relevance . The choice of epitope tags and their placement requires special consideration, as N-terminal tags may interfere with ZDHHC7 membrane insertion, while C-terminal modifications might affect substrate recognition or interaction with regulatory proteins . When establishing stable cell lines, inducible expression systems offer advantages by preventing potential toxicity from constitutive overexpression and allowing for controlled experimental timing . For in vitro reconstitution studies, the selection of appropriate detergents or membrane mimetics is critical, with nanodiscs or proteoliposomes generally providing better preservation of enzymatic activity compared to detergent micelles . Primary cells isolated from ZDHHC7 knockout mice and reconstituted with wild-type or mutant ZDHHC7 can serve as valuable models for structure-function studies in physiologically relevant contexts . When studying ZDHHC7 in complex with substrate proteins, co-expression strategies or sequential purification protocols may be necessary to maintain proper stoichiometry and preserve functional interactions . For activity assays, optimization of reaction conditions including temperature, pH, ion concentrations, and cofactor availability is essential for achieving reproducible and physiologically relevant results across different experimental platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.