Recombinant Human Palmitoyltransferase ZDHHC9 (ZDHHC9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Palmitoyltransferase ZDHHC9

Recombinant Human Palmitoyltransferase ZDHHC9 is an artificially synthesized version of the naturally occurring enzyme ZDHHC9, which belongs to the DHHC family of palmitoyltransferases. This enzyme catalyzes protein palmitoylation, a reversible post-translational modification that involves the covalent attachment of palmitate, a 16-carbon fatty acid, to specific cysteine residues in target proteins . The recombinant form is produced through various expression systems, including cell-free expression platforms that yield purified protein with ≥85% purity as determined by SDS-PAGE analysis .

ZDHHC9 is encoded by the ZDHHC9 gene located on the X chromosome, and is also known by several alternative designations including CGI89, DHHC9, MMSA1, MRXSZ, ZNF379, ZNF380, CXorf11, and ZDHHC10 . The recombinant protein serves as an essential tool for investigating the enzymatic mechanisms of protein palmitoylation and developing potential therapeutic strategies targeting palmitoylation-dependent pathways.

Recombinant ZDHHC9 can be produced through various expression systems, each offering distinct advantages for different research applications:

Expression SystemAdvantagesTypical PurityApplications
Cell-Free ExpressionRapid production, avoids membrane integration challenges≥85%Biochemical assays, antibody production
E. coliHigh yield, cost-effectiveVariableStructural studies, limited functional studies
YeastPost-translational modifications, proper foldingVariableFunctional studies
BaculovirusMammalian-like post-translational modificationsVariableComplex functional assays
Mammalian CellNative-like modifications and foldingVariableHigh-fidelity functional assays

The typical purification process involves affinity chromatography followed by SDS-PAGE verification to ensure purity levels of at least 85% .

Palmitoylation Process

ZDHHC9 catalyzes protein palmitoylation through a two-step mechanism:

  1. Autopalmitoylation: Formation of an enzyme-palmitoyl intermediate through the catalytic DHHC domain

  2. Transpalmitoylation: Transfer of the palmitoyl moiety to a specific cysteine residue in the substrate protein

Naturally occurring variants of ZDHHC9, such as those encoding R148W and P150S mutations, have been shown to affect the autopalmitoylation step by reducing the steady-state amount of the palmitoyl-ZDHHC9 intermediate .

Regulatory Factors

The enzymatic activity of ZDHHC9 is regulated by several factors:

Regulatory FactorEffect on ZDHHC9 Function
GCP16 associationEssential for protein stability and enzymatic activity
Phospholipid bindingRequired for optimal catalytic activity
Palmitoylation statusSelf-palmitoylation at C24, C25, and C288 is essential for catalytic activity
Subcellular localizationGolgi localization positions ZDHHC9 for specific substrate interactions

The ZDHHC9-GCP16 complex represents a critical functional unit, as GCP16 is required for both the stability and palmitoyltransferase activity of ZDHHC9 .

Confirmed Substrates

Recombinant ZDHHC9 demonstrates notable substrate specificity, preferentially palmitoylating certain proteins while showing minimal activity toward others:

SubstrateFunctionPalmitoylation EffectReference
H-RasGTPase signal transductionMembrane localization, activity regulation
N-RasGTPase signal transductionMembrane localization, activity regulation
β-cateninTranscriptional co-activatorPromotes ubiquitination and degradation
Rab3gap1Regulator of Rab3 GTPaseModulates secretory pathway in cardiomyocytes
CD38Transmembrane glycoproteinStabilizes protein expression
PKG1cGMP-dependent protein kinaseRegulates mitochondria-associated ER membranes

Importantly, ZDHHC9 does not efficiently palmitoylate myristoylated G(alphai1) or GAP-43, proteins with N-terminal palmitoylation motifs, demonstrating its substrate selectivity .

X-Linked Intellectual Disability

Mutations in the ZDHHC9 gene have been identified in patients with X-linked intellectual disability (XLID), affecting approximately 2% of XLID cases . Clinical and experimental findings include:

FeatureObservationReference
Clinical presentationMild-to-moderate intellectual disability, seizures, speech/language impairment
Anatomical changesHypoplasia of corpus callosum, 36% reduction in corpus callosum volume
Behavioral phenotypeAltered behavior in open-field test, reduced anxiety, deficits in spatial learning
Cellular mechanismsZDHHC9 knockout disrupts oligodendrocyte subtype proportions and myelination

Renal Fibrosis and Kidney Disease

Recent studies have implicated ZDHHC9 in kidney disease pathophysiology:

FindingMechanismReference
Downregulation in fibrotic kidneysObserved in mouse models and CKD patients
Protection against kidney fibrosisZDHHC9 overexpression protects against fibrosis
β-catenin regulationZDHHC9 palmitoylates β-catenin, promoting its degradation

Cardiovascular Function

ZDHHC9 plays significant roles in cardiac function:

Cardiac RoleMechanismReference
Atrial natriuretic peptide (ANP) regulationModulates Rab3a-mediated exocytosis through Rab3gap1 palmitoylation
Heart failure associationDownregulated in myocardium of heart failure patients
Cardiomyocyte dysfunctionZDHHC9 overexpression leads to dilated cardiomyopathy in aged mice

Cancer Biology

Emerging evidence links ZDHHC9 to cancer progression through various mechanisms:

Cancer AssociationMechanismReference
CD38 palmitoylationStabilizes CD38 expression in cancer cells
TumorigenesisPromotes tumor development in multiple cancer types

Therapeutic Target Exploration

The involvement of ZDHHC9 in multiple disease processes makes it an attractive target for therapeutic development:

Disease AreaTherapeutic ApproachResearch Stage
Kidney fibrosisZDHHC9 enhancement (e.g., iproniazid treatment)Preclinical animal models
X-linked intellectual disabilitySubstrate-specific interventionsExperimental models
Cardiac dysfunctionModulation of ZDHHC9-Rab3gap1-Rab3a pathwayEarly-stage investigation
CancerInhibition of ZDHHC9-mediated CD38 stabilizationConceptual development

Current Limitations and Future Perspectives

Despite significant advances in understanding ZDHHC9 biology, several challenges and opportunities remain:

Technical Challenges

ChallengeImpactPotential Solutions
Membrane protein expressionDifficulties in producing functional recombinant proteinAdvanced membrane protein expression systems, nanodiscs
Assay developmentLimited high-throughput screening capabilitiesDevelopment of cell-based reporter systems
Structural complexityIncomplete understanding of dynamic conformational changesTime-resolved structural techniques

Future Research Directions

Research AreaObjectivesPotential Impact
Substrate identificationComprehensive profiling of ZDHHC9 targetsExpanded understanding of palmitoylation networks
Tissue-specific functionsCharacterization of ZDHHC9 roles in different tissuesTargeted therapeutic strategies
Small molecule modulatorsDevelopment of specific ZDHHC9 activators/inhibitorsNovel therapeutic approaches
Gene therapyCorrection of ZDHHC9 mutationsTreatment for XLID and other ZDHHC9-associated disorders

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC9; CXorf11; ZDHHC10; ZNF379; ZNF380; CGI-89; UNQ261/PRO298; Palmitoyltransferase ZDHHC9; Zinc finger DHHC domain-containing protein 9; DHHC-9; DHHC9; Zinc finger protein 379; Zinc finger protein 380
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC9
Target Protein Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL AVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ RPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAA EAEK
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. It may exhibit palmitoyltransferase activity towards the beta-2 adrenergic receptor/ADRB2, potentially regulating G protein-coupled receptor signaling.
Gene References Into Functions
  1. The results demonstrate that a mutation in ZDHHC9 impacts white matter organization across the entire brain, but also exhibits regionally specific effects, correlating with gene expression variations. PMID: 28168288
  2. Studies suggest that ZDHHC9 may serve as a promising target for developing therapies against NRAS-driven cancers. PMID: 26493479
  3. Data demonstrate that ZDHHC9 mutations are associated with reductions in cortical thickness and white matter microstructural integrity, particularly in regions and networks known to contribute to language function. PMID: 27747153
  4. A de novo ZDHHC9 mutation was identified in a patient with X-linked intellectual disability. PMID: 28687527
  5. The report demonstrated that MMSA-1 is specifically expressed in multiple myeloma patients, and its upregulation is associated with unfavorable clinical features and poor prognosis. PMID: 26493349
  6. ZDHHC9 gene mutation is associated with Lujan-Fryns syndrome. PMID: 26358559
  7. Two missense mutations, R148W and P150S, of zDHHC9, affecting autopalmitoylation, are associated with X-linked intellectual disability. PMID: 24811172
  8. Data indicate that sp-Erf2/zDHHC9 palmitoylates Ras proteins in a highly selective manner in the trans-Golgi compartment to facilitate PM targeting via the trans-Golgi network, a role that is likely crucial for Ras-driven tumorigenesis. PMID: 24248599
  9. MMSA-1 may play a pivotal role in multiple myeloma proliferation and osteolysis destruction. PMID: 22230506
  10. Studies indicate that mutations in DHHC9 were associated with X-linked mental retardation. PMID: 21388813
  11. Data show that H- and N-Ras are palmitoylated by a human protein palmitoyltransferase encoded by the ZDHHC9 and GCP16 genes. PMID: 16000296
  12. DHHC9 is a gastrointestinal-related protein highly expressed in microsatellite stable colorectal cancers. PMID: 17519897

Show More

Hide All

Database Links

HGNC: 18475

OMIM: 300646

KEGG: hsa:51114

STRING: 9606.ENSP00000349689

UniGene: Hs.193566

Involvement In Disease
Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ)
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.

Q&A

What is ZDHHC9 and what is its primary biochemical function?

ZDHHC9 is one of 23 human DHHC acyltransferases that catalyze protein S-acylation, a reversible lipid post-translational modification that regulates protein stability, membrane association, and localization. This enzyme specifically catalyzes the transfer of acyl groups (commonly palmitate) to protein substrates, with Ras proteins being well-established targets. The palmitoylation process occurs through an enzyme-palmitoyl intermediate formation followed by transfer of the palmitoyl moiety to a protein substrate . ZDHHC9 function is particularly important in the brain, with its dysregulation associated with X-linked intellectual disability (XLID) and increased epilepsy risk .

How does the ZDHHC9-GCP16 complex form and function?

ZDHHC9 requires association with an accessory protein, GCP16, to achieve proper enzymatic function. Recent research demonstrates that GCP16 stabilizes ZDHHC9 by preventing its aggregation through protein complex formation. Using size-exclusion chromatography and palmitoyl acyltransferase assays, researchers have confirmed that only properly folded ZDHHC9-GCP16 complexes are enzymatically active in vitro . This interaction is critical for maintaining the structural integrity and functional capacity of ZDHHC9.

What structural features are essential for ZDHHC9 function?

A conserved C-terminal cysteine motif (CCM) is required for ZDHHC9 and GCP16 complex formation and enzymatic activity. This motif is present across the DHHC9 subfamily members (DHHC14, -18, -5, and -8). Co-expression studies have shown that GCP16 improves protein stability of all DHHCs containing this CCM . Additionally, the DHHC domain itself is critical for catalytic activity, with DHHC to DHHA mutations abolishing enzymatic function, as demonstrated in complementation assays .

How do mutations in ZDHHC9 affect protein function and lead to intellectual disability?

Multiple ZDHHC9 mutations have been associated with X-linked intellectual disability (XLID). These pathogenic variants include missense mutations R148W, P150S, and R96W, as well as a non-sense mutation terminating at R298. Experimental investigations have revealed that these mutations result in:

  • Reduced steady-state levels of autopalmitoylated ZDHHC9

  • Increased protein aggregation and reduced monodispersity

  • Compromised ZDHHC9-GCP16 complex formation

Biophysical characterization demonstrates that XLID-associated mutations affect the autopalmitoylation step of the reaction by lowering the steady-state amount of palmitoyl-ZDHHC9 intermediate, though the specific mechanisms may differ between mutations .

What phenotypes are observed in Zdhhc9 knockout mice?

Zdhhc9 knockout mice display significant abnormalities in oligodendrocyte morphology and myelination despite grossly normal oligodendrocyte development. Key phenotypic findings include:

  • Heterogeneous thickness of oligodendrocyte processes with numerous spheroid-like swellings

  • Abnormal patterns of axonal myelination with many large axons remaining unmyelinated while small diameter axons (<0.5 μm) appear hypermyelinated

  • Altered g-ratios indicating irregular myelin thickness relative to axon diameter

  • Decreased density of myelinated axons and disrupted myelin compaction in the corpus callosum

  • Changes in oligodendrocyte subtype proportions with decreased MOL2/3 cells (enriched for myelination genes) and increased MOL5/6 cells (enriched for cell adhesion and synaptic genes)

These findings establish ZDHHC9 as essential for proper oligodendrocyte function and myelination.

How does ZDHHC9 deficiency impact gene expression in oligodendrocytes?

RNA sequencing and proteomic analyses of Zdhhc9 knockout mice have revealed significant alterations in gene expression profiles. Specifically, transcriptomic analysis shows:

  • Reduced expression of genes essential for lipid metabolism, cholesterol synthesis, and myelin compaction

  • Upregulation of genes enriched in oligodendrocyte precursor cells (OPCs)

  • Downregulation of genes enriched in MOL2/3 subtype cells

  • Increased expression of marker genes like Svep1, which is highly enriched in MOL6 oligodendrocytes

These expression changes reflect significant disruptions in the molecular programs governing oligodendrocyte differentiation and myelination capacity.

What techniques can be used to assess ZDHHC9 enzymatic activity?

Several complementary approaches can be employed to analyze ZDHHC9 activity:

  • Radiometric assays: Using H-Ras substrate and [³H]-palmitoyl CoA, followed by quantification via liquid scintillation spectroscopy and fluorography. This method allows direct measurement of both autopalmitoylation and substrate palmitoylation .

  • Yeast-based complementation assays: Testing the in vivo function of ZDHHC9 variants by assessing their ability to complement Ras-related phenotypes in yeast. Typically performed using serial dilutions of transformed cells on selective media containing 5′-fluoroorotic acid .

  • Protein complex formation analysis: Since ZDHHC9 activity requires proper complex formation with GCP16, techniques assessing this interaction (such as co-immunoprecipitation or size-exclusion chromatography) provide indirect measures of functional capacity .

How can researchers evaluate ZDHHC9 protein folding and stability?

The following techniques have proven valuable for assessing ZDHHC9 folding states and stability:

  • Size-exclusion chromatography (SEC): Distinguishes between aggregated (non-functional) and properly folded (functional) states of ZDHHC9 .

  • Fluorescence-detection size-exclusion chromatography (FSEC): Provides higher sensitivity for monitoring protein behavior and complex formation with GCP16 .

  • Co-expression studies: Evaluating how co-expression with GCP16 affects ZDHHC9 stability and folding through comparative SEC profiles .

The table below summarizes the comparison between wild-type and mutant ZDHHC9 folding states:

ZDHHC9 VariantAggregation Without GCP16Improvement With GCP16Enzymatic Activity
Wild-typeModerateSignificantHigh
R148WHighModerateReduced
P150SHighModerateReduced
R96WHighMinimalSignificantly reduced
R298XHighModerateReduced

What approaches are effective for studying the impact of ZDHHC9 on myelination?

Multiple complementary techniques have been employed to characterize myelination defects in Zdhhc9 knockout models:

  • Electron microscopy (EM): Provides high-resolution visualization of myelin ultrastructure, enabling quantification of myelinated vs. unmyelinated axons and assessment of myelin thickness .

  • G-ratio analysis: Quantifies the ratio of axon diameter to total fiber diameter, offering a standardized measure of myelin thickness. In Zdhhc9 KO mice, small diameter axons show altered g-ratios indicating hypermyelination .

  • Sparse genetic labeling: Using fluorescent reporters to visualize individual oligodendrocyte morphology, revealing abnormal process thickness and spheroid-like swellings in Zdhhc9 KO mice .

  • Bioinformatic deconvolution methods: Tools like Bisque can be applied to bulk RNA-seq data to estimate changes in cell type proportions, revealing shifts in oligodendrocyte subtype distribution .

How do different ZDHHC9 mutations produce similar phenotypes through distinct mechanisms?

While ZDHHC9 mutations associated with XLID produce similar clinical presentations, research suggests they operate through different molecular mechanisms. The R148W and P150S mutations specifically affect the autopalmitoylation step of the reaction, reducing the steady-state level of palmitoyl-ZDHHC9 intermediate . Other mutations like R96W severely compromise GCP16 interaction, with co-expression providing minimal rescue of protein folding . Understanding these distinct mechanisms requires:

  • Structure-function analysis correlating mutation position with specific biochemical defects

  • Comparative enzymology assessing each step of the palmitoylation reaction

  • Analysis of substrate specificity alterations in different mutants

  • Assessment of protein-protein interactions beyond GCP16

This mechanistic diversity has important implications for developing targeted therapeutic approaches.

What is the specificity of accessory protein interactions among DHHC subfamily members?

The ZDHHC9 subfamily (DHHC9, -14, -18, -5, and -8) shares the conserved C-terminal cysteine motif (CCM) required for accessory protein interaction. Research indicates differential specificity in these interactions:

  • GCP16 improves protein stability for DHHC9, DHHC14, and DHHC18, and is required for their enzymatic activity

  • GOLGA7B, which shares 75% sequence identity with GCP16, selectively improves protein stability of DHHC5 and DHHC8, but not other subfamily members

This suggests evolutionary divergence in accessory protein requirements, potentially enabling specialized regulation and function of different DHHC enzymes. Further research into the structural basis of these selective interactions could provide insights into palmitoylation regulation in different cellular contexts.

How does ZDHHC9 deficiency disrupt oligodendrocyte subtype determination?

Recent single-cell transcriptomic analyses reveal that Zdhhc9 knockout alters oligodendrocyte subtype proportions, with decreased myelination-associated MOL2/3 cells and increased MOL5/6 cells . This raises fundamental questions about the role of protein palmitoylation in cell fate decisions:

  • What are the key ZDHHC9 substrates in each oligodendrocyte subtype?

  • How does palmitoylation influence transcriptional networks governing subtype specification?

  • Are the observed subtype shifts a direct result of ZDHHC9 loss or compensatory responses?

Addressing these questions will require integration of proteomics to identify ZDHHC9 substrates, transcriptomic analysis across developmental timepoints, and advanced lineage tracing studies.

What techniques can overcome limitations in visualizing ZDHHC9-mediated palmitoylation dynamics?

Current methodologies for studying protein palmitoylation often provide static snapshots rather than dynamic information. Emerging approaches to address this limitation include:

  • Bioorthogonal labeling strategies using alkyne-palmitate analogs coupled with click chemistry

  • Proximity-based enzymatic tagging of palmitoylated proteins

  • FRET-based sensors for real-time visualization of palmitoylation events

  • Advanced mass spectrometry approaches for site-specific and quantitative palmitoylation analysis

These methods would enable researchers to track palmitoylation dynamics in living cells and potentially correlate these events with changes in subcellular localization or protein function.

How can researchers address the technical challenges of studying white matter defects in ZDHHC9 models?

The complex three-dimensional architecture of myelinated axons presents significant technical challenges. Current electron microscopy approaches typically provide two-dimensional cross-sections, which may not fully capture the spatial heterogeneity of myelination defects in Zdhhc9 knockout mice. As noted in the literature, "EM-based reconstruction in 3 dimensions would reveal regions of both hypo- and hypermyelination of individual callosal axons in Zdhhc9 KO mice" . Additional approaches to overcome these limitations include:

  • Serial block-face scanning electron microscopy for 3D reconstruction

  • Advanced diffusion MRI techniques for non-invasive assessment of white matter integrity

  • Live imaging of myelination using zebrafish or ex vivo slice culture models

  • Correlative light and electron microscopy to link molecular markers with ultrastructural features

These approaches would provide a more comprehensive understanding of how ZDHHC9 deficiency affects myelination across different spatial scales.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.