Recombinant Human PDZK1-interacting protein 1 (PDZK1IP1)

Shipped with Ice Packs
In Stock

Description

Introduction to PDZK1IP1

PDZK1-interacting protein 1 (PDZK1IP1), also referred to as MAP17, is a small, non-glycosylated membrane-associated protein with a molecular weight of approximately 17 kDa. It is naturally located in the plasma membrane and Golgi apparatus, particularly in the proximal tubule cells of the kidney. The protein contains two transmembrane regions and a hydrophobic C-terminus that encodes a PDZ-binding domain, enabling its interaction with several PDZ domain-containing proteins, most notably PDZK1 .

Recent investigations have revealed that PDZK1IP1 plays crucial roles in various cellular processes, including cancer progression, inflammatory responses, and adipogenesis. These diverse functions have positioned PDZK1IP1 as a potential therapeutic target for various pathological conditions, particularly skin inflammatory diseases and epithelial tumors .

Structure and Characteristics of Recombinant PDZK1IP1

Recombinant human PDZK1IP1 is produced through genetic engineering techniques to facilitate research into its properties and functions. The protein typically comprises 114 amino acids, with commercially available forms covering either the complete protein sequence (amino acids 1-114) or specific segments (such as amino acids 50-114) .

The structure of PDZK1IP1 is characterized by:

  • Two transmembrane domains

  • A C-terminal PDZ-binding domain crucial for protein-protein interactions

  • Various fusion tags in recombinant forms to facilitate purification and detection

Available Recombinant Forms

Multiple variants of recombinant PDZK1IP1 are commercially available, differing in their fusion tags, expression systems, and covered amino acid sequences. These variations provide researchers with options suited to specific experimental requirements.

Table 1: Commercially Available Recombinant Forms of Human PDZK1IP1

Recombinant FormTag TypeExpression HostPurityApplications
Full-length (AA 1-114)Myc-DYKDDDDKHEK-293 Cells>80%Antibody Production, Standard Applications
Full-length (AA 1-114)GST tagWheat germNot specifiedWestern Blot, ELISA, AP, AA
Full-length (AA 1-114)His tagHEK-293 Cells>90%Western Blot, SDS
Full-length (AA 1-114)Strep TagCell-free protein synthesis>70-80%Western Blot, ELISA, SDS
Partial (AA 50-114)GST tagWheat germNot specifiedWestern Blot, ELISA, AP, AA

The purity of these recombinant proteins is typically assessed using techniques such as SDS-PAGE, Western blot, and in some cases, analytical SEC (HPLC) . The high purity levels (ranging from >70% to >90%) ensure reliable experimental results when these proteins are utilized in research settings.

Expression Systems and Production Methods

Recombinant PDZK1IP1 is produced using various expression systems, each offering distinct advantages for protein production:

HEK-293 Cell Expression

Human Embryonic Kidney 293 (HEK-293) cells represent one of the most widely used expression systems for recombinant PDZK1IP1 production . This mammalian expression system offers several advantages:

  • Provides proper post-translational modifications

  • Ensures correct protein folding

  • Results in high-quality protein with native-like properties

  • Typically achieves purity levels exceeding 80-90% after purification

Alternative Expression Systems

Other expression platforms used for PDZK1IP1 production include:

  • Wheat germ extracts: A cell-free system suitable for producing proteins that may be toxic to living cells

  • Cell-free protein synthesis (CFPS): Allows rapid production without the constraints of cellular viability

The production process typically includes gene cloning, host cell transfection, protein expression, purification via affinity chromatography leveraging fusion tags, and quality control assessment .

Biological Functions of PDZK1IP1

Research has uncovered multiple biological functions of PDZK1IP1, revealing its significance in various cellular processes.

Role in Adipogenesis

PDZK1IP1 functions as a regulator of adipogenesis, with studies in goat subcutaneous preadipocytes demonstrating that it inhibits adipocyte differentiation through the promotion of autophagy . Key findings include:

  • PDZK1IP1 expression is downregulated during preadipocyte differentiation

  • Overexpression of PDZK1IP1 significantly inhibits lipid accumulation in differentiating preadipocytes

  • PDZK1IP1 overexpression decreases expression of adipogenic markers including PPARγ, C/EBPα, and C/EBPβ

  • The inhibitory effect of PDZK1IP1 on adipogenesis is mediated through enhanced autophagy

  • Inhibition of autophagy with NH4CL reverses the anti-adipogenic effects of PDZK1IP1

These findings establish PDZK1IP1 as a negative regulator of adipocyte differentiation, operating through autophagy-dependent mechanisms.

Interaction with NUMB and Notch Pathway Regulation

A particularly significant function of PDZK1IP1 is its interaction with the protein NUMB, which has important implications for cancer development . This interaction involves:

  • Physical binding of PDZK1IP1 to NUMB through the PDZ-binding domain

  • Mislocalization of NUMB due to this interaction

  • Consequent activation of the Notch signaling pathway

  • Increased expression of stem cell-related transcription factors

  • Enhancement of stemness properties in tumor cells

The Notch pathway plays crucial roles in cell fate decisions, proliferation, and differentiation. Its activation by PDZK1IP1 contributes to cancer stem cell development and maintenance . Conversely, downregulation of PDZK1IP1 in tumor cells that constitutively express this gene leads to Notch pathway inactivation and reduced stemness characteristics.

PDZK1IP1 in Cancer

PDZK1IP1 (MAP17) is frequently overexpressed in various tumors and contributes to cancer progression through multiple mechanisms :

  • Interaction with NUMB and subsequent activation of the Notch pathway regulates cancer stem cells

  • Increases cellular plasticity and enhances conversion of progenitor cells to cancer stem cells

  • Direct correlation between MAP17 levels and tumorsphere formation capability in patient-derived xenograft models

  • Strong correlation between MAP17 expression and signatures of Notch and stem cell genes in human colon, breast, and lung cancers

By sequestering NUMB and activating the Notch pathway, PDZK1IP1 potentially contributes to tumor progression, metastasis, and treatment resistance through expansion of the cancer stem cell compartment .

PDZK1IP1 in Inflammatory Diseases

Research has identified PDZK1IP1 as a potential therapeutic target for skin inflammatory diseases . The protein appears to play a significant role in inflammatory responses, as its suppression has been shown to alleviate interferon γ (IFNγ)-induced inflammatory responses in normal human keratinocytes .

Table 2: Key Research Findings on PDZK1IP1 Functions in Disease States

Disease ContextKey FindingsReference
Cancer StemnessInteracts with NUMB, activates Notch pathway, enhances tumor-initiating capacity
Inflammatory Skin DiseasesSuppression alleviates IFNγ-induced inflammatory responses in keratinocytes
Adipose RegulationInhibits preadipocyte differentiation through promoting autophagy

Targeting PDZK1IP1 with Peptide Nucleic Acids

Given the involvement of PDZK1IP1 in various pathological conditions, therapeutic strategies targeting this protein have been explored. A promising approach involves peptide nucleic acids (PNAs), a class of oligonucleotide therapeutics with robust binding affinity to complementary nucleic acid sequences and resistance to degradation by nucleases .

Recent research has shown that:

  • Modified PNA oligomers conjugated with primary amine chains demonstrate enhanced water solubility and cellular permeability

  • Fluorescein-labeled modified PNA oligomers show significantly improved cellular uptake in HaCaT cells compared to unmodified PNAs

  • These modified PNA oligomers effectively suppress PDZK1IP1 gene expression

  • They alleviate interferon γ (IFNγ)-induced inflammatory responses in normal human keratinocytes

These findings suggest the potential application of modified PNAs targeting PDZK1IP1 in the treatment of skin inflammatory diseases and potentially other conditions where PDZK1IP1 plays a pathological role.

PDZK1IP1 as a Target in Cancer Therapy

The role of PDZK1IP1 in regulating cancer stem cells through the Notch pathway suggests its potential as a target for cancer therapy . Several observations support this potential:

  • Downregulation of PDZK1IP1 in tumor cell lines leads to Notch pathway inactivation

  • PDZK1IP1 knockdown results in reduced stemness properties in cancer cells

  • There is a correlation between PDZK1IP1 levels and tumorsphere formation capability in patient-derived xenograft models

  • PDZK1IP1 expression correlates with stem cell signatures in multiple human cancer types

These findings suggest that targeting PDZK1IP1 could impair cancer stem cell function, potentially enhancing sensitivity to conventional therapies and reducing tumor recurrence and metastasis.

Research Methods and Applications

Recombinant PDZK1IP1 proteins serve as valuable tools for investigating the protein's functions and interactions. They are commonly used in various applications:

Experimental Approaches

Table 3: Experimental Approaches for Studying PDZK1IP1

TechniqueApplicationKey FindingsReference
Overexpression StudiesFunctional analysisInhibits adipogenesis, promotes autophagy
RNA InterferenceLoss-of-function analysisReduces autophagy in preadipocytes
CoimmunoprecipitationProtein interaction studiesIdentifies NUMB as interaction partner
Yeast Two-HybridInteraction domain mappingCharacterizes PDZ-binding domain interactions
Patient-derived XenograftsIn vivo relevanceCorrelates PDZK1IP1 with tumorsphere formation

Common Applications

Recombinant PDZK1IP1 proteins are utilized in various research applications:

  • Antibody production for detection of endogenous protein

  • Western blotting, ELISA, and other immunoassays

  • Protein-protein interaction studies

  • Functional assays to assess cellular effects

  • Target validation for therapeutic development

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PDZK1IP1; MAP17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein; Protein DD96
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PDZK1IP1
Target Protein Sequence
MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPE PAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
Uniprot No.

Target Background

Function

PDZK1-interacting protein 1 (PDZK1IP1) may play a significant role in tumor biology.

Gene References Into Functions

Research Highlights on PDZK1IP1 (also known as MAP17) and its role in cancer:

  1. MAP17 shows prognostic potential in lung tumors, particularly lung adenocarcinomas, influencing platinum-based therapy and EGFR inhibitor efficacy. Bortezomib therapy is suggested for adenocarcinomas with high MAP17 expression. PMID: 30119639
  2. MAP17 overexpression activates the Notch pathway by sequestering NUMB, correlating with tumorsphere formation and Notch/stem gene transcription. Direct MAP17 modification alters tumorsphere number and Notch/stem pathway transcription. PMID: 28153862
  3. MAP17 levels are associated with clinical features and poor survival in sarcoma patients, suggesting it as a biomarker for predicting bortezomib efficacy. PMID: 27563810
  4. SGLT2/MAP17 functions as a low-affinity Na(+)-glucose cotransporter in the kidney. PMID: 28592437
  5. PDZK1IP1, along with EEF1A2 and RPL41, shows significant upregulation in intrahepatic cholangiocarcinoma compared to matched paratumor samples. PMID: 27082702
  6. Bortezomib induces a pro-survival response via cytoprotective autophagy and NF-κB nuclear translocation, which is repressed by high MAP17 levels. PMID: 25837675
  7. MAP17 levels are linked to clinical findings and survival in larynx cancer patients. PMID: 25788275
  8. MAP17 and SGLT1 markers might identify patients responding better to treatments increasing oxidative stress in various cancers. PMID: 23418532
  9. MAP17 overexpression is observed in late-stage breast tumors, where oncogenic activity depends on p38 insensitivity to induce intracellular ROS. PMID: 22266858
  10. Th cell cytokine-induced MAP17 upregulation might be linked to filaggrin downregulation in normal epidermal keratinocytes, possibly relating to abnormal epidermal differentiation in dermatological diseases. PMID: 19601982
  11. Genetic screening identified MAP17 as a protein circumventing TNF-α-induced growth arrest. PMID: 17230460
  12. Oncogene-driven MAP17 promoter activation might explain its common overexpression in human carcinomas. PMID: 17426052
  13. MAP17 exhibits tumorigenic capability through a link between sodium-coupled co-transporters and reactive oxygen species. PMID: 17548903
  14. MAP17 activates AKT via ROS, conferring resistance to Myc-induced apoptosis in serum-free conditions. PMID: 17675338
Database Links

HGNC: 16887

OMIM: 607178

KEGG: hsa:10158

STRING: 9606.ENSP00000294338

UniGene: Hs.431099

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed at significant levels only in a single epithelial cell population, the proximal tubular epithelial cells of the kidney. Diffusely expressed in various carcinomas originating from kidney, colon, lung and breast.

Q&A

What is PDZK1-interacting protein 1 (PDZK1IP1) and what are its structural characteristics?

PDZK1-interacting protein 1 (PDZK1IP1), also known as MAP17, is a membrane-associated protein encoded by the PDZK1IP1 gene. The protein contains a typical PDZK1IP1 (MAP17) superfamily domain that enables its specific interactions with other proteins . In goats, the PDZK1IP1 gene consists of 345 base pairs, encoding a protein of 114 amino acids . The protein's structure includes specific regions that are critical for its function, particularly the middle region from Phe^40 to Ala^49, which plays a key role in its Smad4-regulating activity .

The N-terminal region of PDZK1IP1 is particularly important for protein-protein interactions. Studies using deletion mutants have demonstrated that the region between Met^31 and Ala^49 is necessary for PDZK1IP1 to inhibit TGF-β family signaling . Furthermore, the association between PDZK1IP1 mutants and Smad4 becomes weaker in proportion to the loss of the N-terminal length of PDZK1IP1, highlighting the importance of this region for protein function .

How is PDZK1IP1 expression regulated in different tissues and cell types?

PDZK1IP1 expression shows distinct patterns across different tissues and cell types. It is notably expressed in hematopoietic stem cells (HSCs) but is strongly reduced in more differentiated cells or in mobilized HSCs . This specific expression pattern has made it valuable as a marker for HSC populations in research.

In the context of stem cell biology, PDZK1IP1 expression has been leveraged to identify and trace HSCs using transgenic approaches. Studies using bacterial artificial chromosome (BAC) clones to drive transgene expression from the PDZK1IP1 locus have demonstrated that the gene is highly expressed in LSK CD150+ CD48− HSCs, with lower expression in more differentiated progenitor populations . When dissociated from the neighboring Tal1 locus, PDZK1IP1-driven GFP expression becomes even more specific to the HSC population, with approximately 27% of HSCs expressing the transgene, while less than 3% of more differentiated progenitors show expression .

Transcriptional profiling of PDZK1IP1-expressing HSCs reveals a signature associated with the most immature state of these cells, including slightly decreased expression of differentiation markers (e.g., Cd34, Itga2b, and Cd48) and reduced expression of genes associated with proliferation (e.g., Mki67, Ccne2) .

What are the known functions of PDZK1IP1 in cellular processes?

PDZK1IP1 functions as a potent regulator of cell proliferation across different cell types. In goat subcutaneous preadipocytes, overexpression of PDZK1IP1 significantly enhances cell proliferation, as evidenced by increased numbers of EdU-positive cells and greater cell viability . This proliferative effect is accompanied by upregulation of cell cycle-associated genes including CCND1 and CDK2 . Conversely, knockdown of PDZK1IP1 using siRNA techniques inhibits subcutaneous preadipocyte proliferation and downregulates mRNA expression of cell proliferation-associated genes including CCNE1, CCND1, and CDK2 .

Beyond its role in cellular proliferation, PDZK1IP1 serves as a critical regulator of the TGF-β signaling pathway. It inhibits both TGF-β and bone morphogenetic protein (BMP) pathways by interfering with the formation of receptor-regulated Smad (R-Smad)/Smad4 complexes . Rather than affecting R-Smad phosphorylation, PDZK1IP1 retains Smad4 in the cytoplasm of TGF-β-stimulated cells, preventing proper signal transduction .

In functional assays, PDZK1IP1 overexpression suppresses TGF-β-induced reporter activities, cell migration, and cell growth inhibition . In xenograft tumor models where TGF-β elicits tumor-promoting effects, PDZK1IP1 gain of function has been shown to decrease tumor size and increase survival rates, highlighting its potential therapeutic relevance .

How does PDZK1IP1 interact with and regulate the TGF-β signaling pathway?

PDZK1IP1 functions as an inhibitor of the TGF-β signaling pathway through a mechanism that involves direct interaction with Smad proteins, particularly Smad4. Detailed molecular studies have revealed that PDZK1IP1 does not affect receptor-regulated Smad (R-Smad) phosphorylation but rather interferes with the formation of R-Smad/Smad4 complexes following TGF-β stimulation .

The interaction between PDZK1IP1 and Smad proteins is dependent on ALK5 activation. Particularly strong interactions have been observed between PDZK1IP1 and both Smad2 and Smad4 . Proximity ligation assays (PLA) have confirmed the endogenous interaction between PDZK1IP1 and Smad4, with red fluorescent dots appearing only after TGF-β stimulation in cells expressing PDZK1IP1 . Knockdown of PDZK1IP1 abolishes this interaction, further confirming the specificity of the observed protein-protein interaction .

Mechanistically, PDZK1IP1 retains Smad4 in the cytoplasm even after TGF-β stimulation. Immunofluorescence studies have demonstrated that while Smad4 localizes to the nucleus upon TGF-β stimulation in the absence of PDZK1IP1, overexpression of PDZK1IP1 results in cytoplasmic retention of Smad4 . This spatial sequestration prevents Smad4 from fulfilling its role as a transcriptional co-factor.

Functional consequences of this interaction include suppression of TGF-β-induced reporter activities, decreased cell migration, and inhibition of TGF-β-mediated cell growth arrest . PDZK1IP1 knockdown enhances the expression of TGF-β target genes such as Smad7 and TMEPAI upon TGF-β stimulation, further supporting its role as a negative regulator of this pathway .

What methods are most effective for studying PDZK1IP1's role in cell proliferation?

Research on PDZK1IP1's role in cell proliferation has employed several complementary methodologies that collectively provide robust insights into its function. These approaches include:

  • Gain and loss of function studies: Overexpression of PDZK1IP1 using expression vectors and knockdown using siRNA techniques have been particularly effective for determining the protein's role in cell proliferation . These approaches allow researchers to directly observe the effects of altered PDZK1IP1 levels on cellular phenotypes.

  • EdU incorporation assays: 5-ethynyl-2'-deoxyuridine (EdU) incorporation followed by fluorescence detection provides a direct measurement of DNA synthesis, reflecting cell proliferation rates. This technique has demonstrated that PDZK1IP1 overexpression significantly increases the percentage of EdU-positive cells in culture .

  • Cell viability assays: Techniques such as MTT or CCK-8 assays offer quantitative measurements of cell proliferation and viability. These assays have shown enhanced cell viability in PDZK1IP1-overexpressing cells .

  • Gene expression analysis: Quantitative PCR analysis of cell cycle-associated genes (CCND1, CCNE1, CDK2) provides molecular evidence for PDZK1IP1's effects on proliferation pathways. Both upregulation of these genes following PDZK1IP1 overexpression and downregulation after PDZK1IP1 knockdown have been observed .

  • In vitro cell culture models: Primary cultures of cells such as preadipocytes offer physiologically relevant systems for studying PDZK1IP1 function in specific cell types .

  • Transgenic reporter systems: For tracking PDZK1IP1 expression in complex tissues, BAC-based transgenic approaches using fluorescent proteins like GFP have proven valuable .

How does PDZK1IP1 influence hematopoietic stem cell function and identification?

PDZK1IP1 has emerged as a significant marker for hematopoietic stem cells (HSCs), with expression patterns that correlate with stemness and self-renewal capacity. PDZK1IP1-GFP transgene expression has been used to identify and isolate HSC populations with enhanced long-term repopulation abilities .

Transcriptional profiling of PDZK1IP1-expressing HSCs reveals a molecular signature associated with the most primitive state of these cells. Compared to PDZK1IP1-negative HSCs, PDZK1IP1-positive HSCs exhibit slightly decreased expression of differentiation markers (e.g., Cd34, Itga2b, and Cd48) and reduced expression of genes associated with proliferation (e.g., Mki67, Ccne2) . This molecular profile aligns with the characteristics of deeply quiescent HSCs that maintain long-term self-renewal capacity.

Single-cell transplantation experiments have shown that PDZK1IP1-positive HSCs can generate multilineage reconstitution, with 5 out of 14 primary recipients showing reconstitution of multiple lineages (corresponding to α-HSCs), while 8 out of 14 primarily reconstituted granulocytes (corresponding to β-HSCs) . This heterogeneity within the PDZK1IP1-expressing population reflects the known functional diversity of the HSC compartment.

What is the relationship between PDZK1IP1 and its interacting protein PDZK1?

While PDZK1IP1 (PDZK1-interacting protein 1) derives its name from its interaction with PDZK1, these proteins function in distinct but potentially interconnected pathways. PDZK1 contains four PSD-95/Dlg/ZO-1 (PDZ) domains, with the first domain in the N-terminal region responsible for association with the scavenger receptor class B type I (SR-BI), a high-density lipoprotein (HDL) receptor .

PDZK1 plays a crucial role in controlling hepatic SR-BI expression through post-transcriptional mechanisms both in cell culture and in vivo . The C-terminal region of PDZK1 is essential for up-regulating SR-BI protein expression, and this region contains serine residues that undergo phosphorylation .

Specifically, PDZK1 is phosphorylated at Ser-509 by cAMP-dependent protein kinase A (PKA) both in vitro and in cell culture . This phosphorylation event is functionally significant, as a mutant PDZK1 with Ser-509 replaced by Ala loses the ability to up-regulate SR-BI protein . Physiological relevance of this phosphorylation is supported by the observation that administration of glucagon to rats increases PDZK1 phosphorylation along with hepatic SR-BI and PDZK1 expression, while simultaneously decreasing plasma HDL levels .

The functional relationship between PDZK1 and PDZK1IP1 in regulating common pathways requires further investigation, but their shared involvement in membrane protein regulation suggests potential coordinated activities in cellular signaling and metabolic processes.

What expression systems are optimal for producing recombinant human PDZK1IP1?

Based on the available research literature, several expression systems have been successfully employed for producing recombinant PDZK1IP1 for functional studies. While the search results don't specifically detail expression systems for PDZK1IP1, we can infer appropriate methods from the experimental approaches described:

  • Mammalian cell expression systems: For studies examining PDZK1IP1's interaction with TGF-β signaling components, mammalian expression vectors encoding PDZK1IP1 with epitope tags (such as HA) have been used for transient transfection into cell lines like A549 and PC-3 . These systems provide proper post-translational modifications and cellular localization.

  • Bacterial artificial chromosome (BAC) transgenic approaches: For in vivo expression studies, particularly in stem cell biology, BAC clones containing the PDZK1IP1 locus have been used to direct the expression of reporter proteins like GFP . This approach maintains the natural regulatory elements controlling PDZK1IP1 expression.

  • Lentiviral expression systems: For stable expression or expression in primary cells, lentiviral vectors carrying the PDZK1IP1 cDNA may provide advantages in terms of integration efficiency and expression stability.

When selecting an expression system for recombinant human PDZK1IP1, researchers should consider:

  • The need for post-translational modifications

  • The requirement for membrane localization

  • The experimental context (in vitro vs. in vivo studies)

  • The intended application (structural studies, functional assays, protein-protein interaction analysis)

For producing pure recombinant protein for biochemical studies, insect cell-based systems (such as baculovirus) might offer a good balance between proper folding/modifications and yield, though this would need to be empirically determined for PDZK1IP1.

What techniques are most effective for analyzing PDZK1IP1 protein-protein interactions?

Multiple complementary techniques have been successfully employed to study PDZK1IP1's protein-protein interactions, particularly with Smad proteins:

How can researchers effectively design experiments to study PDZK1IP1's role in different signaling pathways?

When designing experiments to investigate PDZK1IP1's role in signaling pathways, researchers should consider a multi-faceted approach that addresses both mechanistic aspects and functional outcomes:

  • Pathway-specific reporter assays: Luciferase reporter constructs containing response elements for specific pathways (such as the (CAGA)12-luc reporter for TGF-β signaling) provide quantitative readouts of pathway activity . Comparing reporter activity in the presence and absence of PDZK1IP1 (through overexpression or knockdown) can reveal pathway-specific effects.

  • Protein-protein interaction studies: As PDZK1IP1 functions primarily through protein interactions, techniques such as co-immunoprecipitation, proximity ligation assays, and co-localization studies should be employed to identify and characterize interactions with key pathway components .

  • Subcellular localization analyses: Examining the localization of pathway components (such as Smad4) in the presence and absence of PDZK1IP1 can reveal mechanisms by which PDZK1IP1 regulates signaling. Immunofluorescence microscopy with compartment-specific markers is particularly useful for this purpose .

  • Gain and loss of function approaches: Both overexpression and knockdown/knockout studies should be conducted to comprehensively assess PDZK1IP1's role. These can be implemented using transient transfection, stable cell lines, or inducible systems depending on the experimental requirements .

  • Downstream target gene analysis: Examining the expression of known pathway target genes (such as Smad7 and TMEPAI for TGF-β signaling) provides functional validation of PDZK1IP1's effects on signaling output .

  • Domain mapping and structure-function analyses: Creating and testing mutant versions of PDZK1IP1 with specific domain deletions or point mutations can identify regions critical for interaction with pathway components and for functional effects .

  • Context-dependent studies: As signaling pathways can function differently in different cell types or physiological contexts, experiments should be conducted in multiple relevant cell types and under various stimulation conditions.

What is the potential significance of PDZK1IP1 in disease processes and therapeutic applications?

PDZK1IP1 has demonstrated significant roles in cellular processes that are relevant to multiple disease states, suggesting potential therapeutic applications:

  • Cancer biology: PDZK1IP1 inhibits TGF-β signaling, which has context-dependent roles in cancer progression. In xenograft tumor models where TGF-β elicits tumor-promoting effects, PDZK1IP1 gain of function has been shown to decrease tumor size and increase survival rates . This suggests that modulating PDZK1IP1 expression or activity could potentially alter cancer progression in certain contexts.

  • Stem cell biology: PDZK1IP1 expression marks hematopoietic stem cells with enhanced self-renewal capacity and long-term repopulation potential . This finding has implications for stem cell transplantation therapies, where identifying and selecting HSCs with optimal regenerative potential is crucial for treatment success.

  • Metabolic regulation: Through its relationship with PDZK1, which regulates SR-BI protein levels and influences HDL metabolism, PDZK1IP1 may indirectly affect cholesterol metabolism and cardiovascular health . Given that plasma HDL concentrations are inversely related to cardiovascular disease risk, understanding this regulatory pathway could inform therapeutic strategies for dyslipidemia.

  • Cell proliferation: PDZK1IP1 promotes cell proliferation in multiple cell types, including subcutaneous preadipocytes . This proliferative effect could be relevant for tissue regeneration applications or, conversely, might need to be inhibited in hyperproliferative disorders.

Potential therapeutic strategies targeting PDZK1IP1 could include:

  • Small molecule modulators of PDZK1IP1-protein interactions, particularly focusing on the critical middle region (Phe^40 to Ala^49)

  • Gene therapy approaches to modulate PDZK1IP1 expression in specific tissues

  • Peptide-based inhibitors designed to disrupt PDZK1IP1's interaction with key signaling proteins like Smad4

How do researchers resolve contradictory findings about PDZK1IP1 function across different experimental systems?

Contradictory findings regarding PDZK1IP1 function across different experimental systems can be resolved through several methodological approaches:

  • Context-dependent analysis: PDZK1IP1 may have different functions in different cell types or physiological contexts. For instance, while PDZK1IP1 promotes proliferation in subcutaneous preadipocytes , its interaction with the TGF-β pathway suggests it might inhibit proliferation in contexts where TGF-β has an anti-proliferative effect . Systematic studies across multiple cell types can help delineate these context-dependent functions.

  • Pathway integration: PDZK1IP1 likely functions within a complex network of interacting pathways. Apparent contradictions might arise from focusing on isolated pathways rather than considering the integrated cellular response. Network analysis approaches can help map these interactions.

  • Isoform-specific functions: If PDZK1IP1 exists as multiple isoforms, these may have distinct or even opposing functions. Isoform-specific reagents and analyses can help clarify such differences.

  • Dose-dependent effects: PDZK1IP1 might exhibit different effects at different expression levels. Titration experiments using inducible expression systems can help characterize such dose-dependent responses.

  • Temporal dynamics: The timing of PDZK1IP1 expression relative to other cellular events might influence its functional outcomes. Time-course experiments with precise control of PDZK1IP1 expression can address this possibility.

  • Post-translational modifications: Different experimental systems might result in different patterns of post-translational modifications on PDZK1IP1, potentially altering its function. Mass spectrometry-based proteomics can help identify and characterize such modifications.

  • Multiparameter analysis: Simultaneously measuring multiple functional outcomes (proliferation, migration, differentiation, etc.) in the same experimental system can provide a more comprehensive understanding of PDZK1IP1's effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.