Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP8 (FKBP8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Peptidyl-prolyl cis-trans Isomerase FKBP8

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP8 (FKBP8) is a protein produced through recombinant DNA technology. It belongs to the family of FK506 binding proteins, which are known for their peptidyl-prolyl cis-trans isomerase activity. This enzyme plays a crucial role in protein folding and has been implicated in various cellular processes, including autophagy and mitochondrial dynamics.

Production and Sources of Recombinant FKBP8

Recombinant FKBP8 can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells. Each system offers different advantages in terms of yield, purity, and post-translational modifications. For example, yeast and E. coli are commonly used for large-scale production due to their high yield and cost-effectiveness, while mammalian cells provide more authentic post-translational modifications .

Expression SystemAdvantagesDisadvantages
YeastHigh yield, cost-effectiveLimited post-translational modifications
E. coliHigh yield, cost-effectiveLimited post-translational modifications
BaculovirusHigh yield, suitable for complex proteinsRequires insect cell culture
Mammalian CellsAuthentic post-translational modificationsLower yield, higher cost

Biological Functions of FKBP8

FKBP8 is involved in several critical biological processes:

  • Mitochondrial Dynamics and Autophagy: FKBP8 facilitates mitochondrial fragmentation, which is essential for mitophagy, a process by which damaged mitochondria are degraded to maintain cellular health .

  • Protein Folding: As a peptidyl-prolyl cis-trans isomerase, FKBP8 helps in the proper folding of proteins, which is crucial for their function and stability.

  • Interaction with Other Proteins: FKBP8 interacts with proteins like VISA, suggesting its role in signaling pathways .

Research Findings and Implications

Recent studies have highlighted the importance of FKBP8 in autophagy regulation. The absence of FKBP8 impairs autophagy activation, indicating its role as a regulatory protein in starvation-activated autophagy . Additionally, FKBP8 variants have been associated with spina bifida, suggesting its involvement in developmental processes .

Tissue Expression and Localization

FKBP8 exhibits cytoplasmic expression with a granular pattern in most cell types, as observed in human tissues. This widespread expression underscores its potential role in various cellular processes across different tissues .

Clinical and Therapeutic Potential

Given its involvement in autophagy and mitochondrial dynamics, FKBP8 may have implications for diseases related to mitochondrial dysfunction or impaired autophagy. Further research is needed to explore its therapeutic potential.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
FKBP8; FKBP38; Peptidyl-prolyl cis-trans isomerase FKBP8; PPIase FKBP8; 38 kDa FK506-binding protein; 38 kDa FKBP; FKBP-38; hFKBP38; FK506-binding protein 8; FKBP-8; FKBPR38; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FKBP8
Target Protein Sequence
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLA ANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLE HQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTE TALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Uniprot No.

Target Background

Function

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP8 (FKBP8) is a constitutively inactive peptidyl-prolyl isomerase that becomes active upon binding to calmodulin and calcium. It functions as a chaperone for BCL2, targeting it to the mitochondria and modulating its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex likely interferes with BCL2's interaction with its targets. Therefore, the active form of FKBP8 may play a significant role in apoptosis regulation.

Gene References Into Functions

Relevant Research Publications:

  1. The dynamic interplay between Rheb and FKBP38: PMID: 29194576
  2. FKBP8 and Hsp90β in CLC-1 chloride channel biosynthesis: PMID: 27580824
  3. FKBP8 and LC3A in mitophagy induction: PMID: 28381481
  4. FKBP8 binding to Hsp90 and ATPase activity: PMID: 28278223
  5. Catalytic activity and regulation of FKBP38: PMID: 24145868
  6. S100P and FKBP38 interaction with Bcl-2: PMID: 24295050
  7. FKBP8 in CFTR folding and stability: PMID: 22474283
  8. Structural model of Bcl-2 and FKBP38 catalytic domain complex: PMID: 22523079
  9. Dual role of FKBP38 in CFTR regulation: PMID: 22030396
  10. PA activation of mTORC1 and FKBP38 displacement: PMID: 21737445
  11. Charge-sensitive site in FKBP domain regulation: PMID: 20140889
  12. Structural arrangement of FKBP38/calmodulin complex: PMID: 20707607
  13. FKBP38 and caspase-dependent degradation of Bcl-2: PMID: 20139069
  14. Rheb GTPase, FKBP38, Bcl-2, and Bcl-XL interaction: PMID: 20048149
  15. FKBP38 and TSC gene-dependent cell size regulation: PMID: 12894220
  16. Bcl-2 and FKBP38 interaction and phosphorylation: PMID: 15733859
  17. FKBP38 and calcineurin subcellular distribution: PMID: 15757646
  18. Molecular model of FKBP38 FK506-binding domain: PMID: 16604427
  19. NS5A, FKBP8, and Hsp90 in HCV RNA replication: PMID: 17024179
  20. FKBP38 and PHD2 protein stability: PMID: 17353276
  21. FKBP38 and HERG potassium channel trafficking: PMID: 17569659
  22. FKBP38 and 26S proteasome anchoring: PMID: 17573772
  23. FKBP38, calmodulin, and Bcl-2 regulation: PMID: 17942410
  24. FKBP38 as an endogenous inhibitor of mTOR: PMID: 17991864
  25. NS5A and FKBP8 interaction in HCV replication: PMID: 18216108
  26. FKBP38 as a Rheb effector in mTOR activation: PMID: 18658153
  27. TCTP and FKBP38 in mTORC1 signaling: PMID: 18676370
  28. FKBP38 and mTORC1 activation: PMID: 19222999
  29. PHD2 protein stability and FKBP38-mediated proteasomal interaction: PMID: 19546213
Database Links

HGNC: 3724

OMIM: 604840

KEGG: hsa:23770

STRING: 9606.ENSP00000222308

UniGene: Hs.173464

Subcellular Location
Mitochondrion. Mitochondrion membrane; Single-pass membrane protein; Cytoplasmic side.; [Isoform 1]: Mitochondrion membrane; Single-pass membrane protein; Cytoplasmic side.; [Isoform 3]: Mitochondrion membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Widely expressed. Highest levels seen in the brain. Highly abundant in the retina.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.