Recombinant Human Peroxisomal biogenesis factor 3 (PEX3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Peroxisomal Biogenesis Factor 3 (PEX3)

Recombinant Human Peroxisomal Biogenesis Factor 3 (PEX3) is a protein crucial for the biogenesis and integrity of peroxisomes, which are organelles involved in various metabolic processes, including fatty acid oxidation and detoxification. PEX3 is an integral membrane protein that plays a pivotal role in the early stages of peroxisome formation by serving as a receptor for PEX19, a cytosolic protein that recognizes and delivers newly synthesized peroxisomal membrane proteins (PMPs) to the peroxisomal membrane .

Structure

PEX3 adopts a novel fold described as a large helical bundle. It contains a hydrophobic groove at its membrane-distal end, which engages with a PEX19-derived peptide with high affinity. This interaction is critical for the recognition and delivery of PMPs to peroxisomes .

Function

PEX3 is essential for the assembly of peroxisomal membranes and the correct translocation of PMPs. It is involved in the early steps of peroxisome biogenesis, facilitating the formation of mature peroxisomes from preperoxisomal vesicles (PPVs) . In addition to its role in biogenesis, PEX3 also participates in peroxisome inheritance by interacting with myosin motors, ensuring the proper distribution of peroxisomes during cell division .

Role in Disease and Development

Defects in the PEX3 gene are associated with peroxisomal biogenesis disorders (PBDs), such as Zellweger syndrome, which is characterized by severe neurological and developmental abnormalities due to impaired peroxisome function . Recent studies suggest that PEX3 may also play a role in myocardial regeneration, as its expression affects heart tissue repair after injury .

Research Findings

Aspect of PEX3DescriptionSource
StructureLarge helical bundle with a hydrophobic groove for PEX19 interaction
FunctionEssential for peroxisomal membrane biogenesis and PMP translocation
Disease AssociationLinked to Zellweger syndrome and potentially involved in myocardial regeneration
Cellular RoleInvolved in peroxisome inheritance and stress responses in fungi

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX3; Peroxisomal biogenesis factor 3; Peroxin-3; Peroxisomal assembly protein PEX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PEX3
Target Protein Sequence
MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSTVAVY STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI TVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMP DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN VYEAFSTPQQLEK
Uniprot No.

Target Background

Function

Recombinant Human Peroxisomal Biogenesis Factor 3 (PEX3) is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles prior to the translocation of matrix proteins and acts as a docking factor for PEX19, which is crucial for the import of peroxisomal membrane proteins into peroxisomes.

Gene References Into Functions

Further Research Supporting PEX3 Function:

  1. PEX19 and PEX3 provide an alternative post-translational pathway for membrane insertion of reticulon homology domain-containing proteins, suggesting coordination between endoplasmic reticulum membrane shaping and peroxisome biogenesis. PMID: 29396426
  2. Newly synthesized UBXD8 is post-translationally inserted into specific ER subdomains, a process requiring cytosolic PEX19 and membrane-integrated PEX3. PMID: 27295553
  3. ER insertion of PEX3 is physiologically relevant. PMID: 26572236
  4. PEX16 mediates peroxisomal trafficking of PEX3 and PMP34 via the endoplasmic reticulum. PMID: 25002403
  5. PEX19 stabilizes PEX3, preventing aggregation. PMID: 25062251
  6. Mutations in the PEX19-binding domain of PEX3 reduce PEX19 affinity and destabilize PEX3. PMID: 22624858
  7. The Pex19p peptide contains a critical motif (Leu18, Leu21, Leu22, Phe29) for Pex3p binding and peroxisome biogenesis. PMID: 21102411
  8. The crystal structure of the PEX3 cytosolic domain complexed with a PEX19-derived peptide reveals a novel helical bundle fold. PMID: 20554521
  9. PEX3 and PEX19 interaction is visualized by FRET. PMID: 14713233
  10. PEX3 plays a selective, essential, and direct role in class I peroxisomal membrane protein import as a PEX19 docking factor. PMID: 15007061
  11. Pex19p functions as a chaperone, transporting membrane proteins to peroxisomes by anchoring to Pex3p. PMID: 16895967
  12. Trp-104 and Trp-224 of Pex3p are involved in Pex19p binding. PMID: 18174172
  13. Pex3p follows the ER-to-peroxisomal route, requiring Pex16p for ER localization. PMID: 19479899
  14. The PEX3 cytosolic domain binds membrane lipids. PMID: 19715730
Database Links

HGNC: 8858

OMIM: 603164

KEGG: hsa:8504

STRING: 9606.ENSP00000356563

UniGene: Hs.592832

Involvement In Disease
Peroxisome biogenesis disorder complementation group 12 (PBD-CG12); Peroxisome biogenesis disorder 10A (PBD10A); Peroxisome biogenesis disorder 10B (PBD10B)
Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Found in all examined tissues.

Q&A

What is the fundamental role of PEX3 in peroxisome biogenesis?

PEX3 plays a central role in peroxisomal membrane biogenesis as a membrane-anchored receptor for cytosolic PEX19. The protein is essential for assembling membrane vesicles before the matrix proteins are translocated to peroxisomes. This process is critical because it establishes the peroxisomal membrane framework necessary for subsequent import of peroxisomal matrix proteins .

Methodologically, researchers can demonstrate PEX3's function by:

  • Conducting complementation assays in PEX3-deficient cells

  • Performing localization studies using fluorescently tagged PEX3

  • Analyzing phenotypes in cells with reduced PEX3 expression through RNA interference techniques

Studies have shown that transient reduction of PEX3 levels through siRNA techniques blocks recruitment of the PEX19 docking domain to peroxisomes, confirming its essential role in the peroxisome assembly pathway .

How does the structure of PEX3 relate to its function?

The crystallographic structure of PEX3 reveals that it adopts a novel fold described as a large helical bundle. The cytosolic domain of PEX3 (comprising residues 41-373) contains a hydrophobic groove at its membrane-distal end that engages with PEX19 with nanomolar affinity . This interaction is critical for peroxisomal membrane protein import.

Key structural features include:

  • A solvent-exposed cysteine at position 235 (often mutated to serine in experimental constructs to prevent non-native oxidation)

  • Highly conserved residues involved in PEX19 binding, suggesting evolutionary importance

  • A membrane-distal hydrophobic groove that forms the binding interface with PEX19

Resolution of the PEX3-PEX19 peptide complex structure (PDB accession code 3MK4) has provided valuable insights into the molecular mechanisms underlying peroxisomal membrane biogenesis .

What experimental models are most suitable for studying PEX3 function?

The following experimental models have proven valuable for PEX3 research:

Model SystemAdvantagesKey Applications
Human fibroblastsPhysiologically relevant, suitable for disease modelingPatient-derived cells for studying disease mechanisms
Yeast (S. cerevisiae)Genetic manipulation ease, conserved peroxisome biogenesisHigh-throughput screens, protein interaction studies
Recombinant expression systemsControlled expression, protein purificationStructural studies, in vitro binding assays
siRNA knockdown modelsTransient reduction of PEX3 expressionFunctional studies of PEX3 dependency

In yeast models, deletion of PEX11 results in enlarged peroxisomes, which can improve spatial resolution when studying PEX3 localization and interaction with other peroxisomal proteins .

How do mutations in the PEX3 gene impact peroxisomal membrane synthesis?

Mutations in the PEX3 gene can severely disrupt peroxisomal membrane synthesis, leading to peroxisomal biogenesis disorders such as Zellweger syndrome. Research has identified specific mutations that interfere with proper PEX3 function:

  • Splice site mutations: A mutation at position -8 of the splice-site consensus region can cause exon skipping, resulting in a truncated protein. In one study, a point mutation led to the complete deletion of exon 11 (97 bp), causing a frameshift and premature termination, predicting a 56-amino-acid C-terminal truncation .

  • Functional impairment: In vitro binding assays demonstrate that truncated PEX3 proteins fail to bind PEX19, suggesting that PEX3 mutations disrupt the essential interaction between these early peroxins .

Methodologically, researchers investigating PEX3 mutations should:

  • Perform reverse transcription-PCR to detect splicing abnormalities

  • Conduct in vitro binding assays to assess protein-protein interactions

  • Use cellular complementation assays to evaluate functional rescue

These approaches can help determine how specific mutations affect PEX3 function and contribute to disease pathogenesis .

What are the optimal approaches for expressing and purifying recombinant human PEX3?

For structural and functional studies, researchers must carefully consider several methodological aspects when expressing and purifying recombinant human PEX3:

AspectRecommendationRationale
Expression constructCytosolic domain (residues 41-373) with C235S mutationPrevents non-native oxidation while maintaining functional domains
Expression systemE. coli or insect cell systemsBacteria for cytosolic domain; insect cells for full-length protein
Purification strategyMulti-step approach: affinity chromatography followed by size exclusionEnsures high purity for structural studies
Buffer optimizationInclude stabilizing agents (glycerol, reducing agents)Prevents aggregation and oxidation
Quality controlSEC-MALS, thermal shift assaysValidates proper folding and monodispersity

Previous successful approaches include using the cytosolic domain of PEX3 (residues 41-373) with a C235S mutation to prevent non-native oxidation . This construct has been successfully crystallized in complex with a PEX19-derived peptide, yielding high-resolution structural data.

How can researchers investigate the role of PEX3 in peroxisome-lipid droplet contact sites?

Recent studies have revealed that PEX3 promotes the formation of peroxisome-peroxisome and peroxisome-lipid droplet contact sites, particularly when overexpressed. To investigate this phenomenon:

  • Genetic approaches:

    • Overexpress PEX3 using strong promoters (e.g., TEF1 promoter in yeast)

    • Delete PEX11 to enlarge peroxisomes for better visualization

    • Perform genome-wide screens to identify factors affecting contact site formation

  • Microscopy techniques:

    • Use fluorescent protein tags (BFP-SKL for peroxisome matrix, Pex13-mNeonGreen for peroxisome membrane)

    • Apply lipid droplet markers (Erg6-2xmKate2 or Bodipy staining)

    • Employ high-resolution imaging with z-stack acquisition

  • Quantitative analysis:

    • Perform line profile measurements around contact sites

    • Calculate Manders M1 and M2 coefficients for colocalization

    • Measure border-to-border distances between organelles

A recent study found that increasing PEX3 levels in yeast cells led to clusters of peroxisomes closely associated with lipid droplets. Notably, deletion of the lipase Tgl4 disrupted this phenotype, indicating potential functional relevance of these contact sites in lipid metabolism .

What experimental approaches are effective for studying the PEX3-PEX19 interaction dynamics?

The critical interaction between PEX3 and PEX19 can be studied using the following methodological approaches:

  • Structural studies:

    • X-ray crystallography of the PEX3-PEX19 complex

    • NMR spectroscopy for dynamic interaction studies

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Biophysical techniques:

    • Isothermal titration calorimetry (ITC) to measure binding affinities

    • Surface plasmon resonance for real-time interaction kinetics

    • FRET-based assays for studying interactions in living cells

  • Functional assays:

    • siRNA-based knockdown of PEX3 to study effects on PEX19 localization

    • Pull-down assays with GST-PEX19 fusion proteins

    • In vitro binding assays with wild-type and mutant proteins

Current evidence shows that the PEX19 peptide spanning residues 14-33 binds to PEX3 with nanomolar affinity, with phenylalanine 29 in PEX19 being critical for this interaction . Researchers have successfully used PEX3 siRNA to demonstrate that reduced PEX3 levels prevent recruitment of the PEX19 docking domain to peroxisomal membranes .

How can CRISPR-Cas9 technology be applied to create cellular models of PEX3 deficiency?

CRISPR-Cas9 genome editing offers powerful approaches for creating precise PEX3-deficient cellular models:

StrategyMethodologyResearch Application
Complete knockoutCRISPR-Cas9 targeting exon 1 or critical functional domainsStudy complete loss-of-function phenotypes
Conditional knockoutFloxed PEX3 alleles with inducible Cre expressionTemporal control of PEX3 expression
Knock-in mutationsHDR-mediated introduction of patient-specific mutationsModel disease-causing variants
Tagged endogenous PEX3C-terminal fluorescent protein fusionTrack native PEX3 dynamics
Point mutationsBase editors for introducing specific amino acid changesStructure-function relationships

When designing gRNAs, researchers should target conserved regions of PEX3 that are essential for function, such as the PEX19-binding domain. Following CRISPR editing, validation should include:

  • Western blotting to confirm protein absence/modification

  • Immunofluorescence to assess peroxisome morphology

  • Functional assays to verify peroxisomal import defects

  • Complementation studies with wild-type PEX3 to confirm specificity

These models can provide valuable insights into PEX3 function and the pathogenic mechanisms of peroxisomal biogenesis disorders.

What are the common challenges in working with recombinant PEX3 and how can they be addressed?

Researchers working with recombinant PEX3 face several technical challenges:

  • Protein solubility issues:

    • Challenge: Full-length PEX3 contains a transmembrane domain making it difficult to express in soluble form

    • Solution: Use the cytosolic domain (residues 41-373) for most applications; mutation of C235S prevents non-native oxidation

  • Structural instability:

    • Challenge: PEX3 may form aggregates during purification and storage

    • Solution: Optimize buffer conditions with stabilizing agents; perform thermostability assays to identify optimal conditions

  • Binding partner co-expression:

    • Challenge: Difficulty in co-crystallizing PEX3 with full-length PEX19

    • Solution: Use PEX19-derived peptides (residues 14-33) that contain the essential binding region

  • Alternative translation initiation:

    • Challenge: In vitro translation of wild-type PEX3 yields two proteins of differing molecular weight due to an internal start codon at position 199

    • Solution: Design constructs that specifically eliminate the internal start codon or use specific antibodies that distinguish between the two forms

How can researchers effectively analyze PEX3-dependent peroxisomal phenotypes in cellular models?

To thoroughly analyze PEX3-dependent peroxisomal phenotypes:

  • Morphological assessment:

    • Immunofluorescence microscopy with peroxisomal markers (matrix and membrane)

    • Quantification of peroxisome number, size, and distribution

    • Electron microscopy for ultrastructural analysis

  • Functional assays:

    • Measurement of peroxisomal enzyme activities (catalase, β-oxidation)

    • Analysis of very long-chain fatty acid levels

    • Import assays for peroxisomal matrix and membrane proteins

  • Protein localization studies:

    • Fractionation techniques to isolate peroxisomes

    • Protease protection assays to determine protein topology

    • Live-cell imaging with fluorescently tagged peroxisomal proteins

  • Quantitative analysis methods:

    • Apply maximum entropy threshold to images for objective analysis

    • Use JACoP plugin for ImageJ to determine Manders coefficient for colocalization studies

    • Employ 3D ROI manager for precise measurement of organelle distances

When studying peroxisome-lipid droplet associations, researchers should include appropriate controls and consider using enlarged peroxisomes (e.g., in Pex11Δ cells) to gain better spatial resolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.