Recombinant Human Peroxisomal membrane protein 11A (PEX11A)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Peroxisome Biology

PEX11A regulates peroxisomal proliferation and membrane dynamics through distinct mechanisms:

Membrane Elongation and Division

  • Overexpression Effects: Induces membrane protrusions and elongated peroxisomes (juxtaposed elongated peroxisomes, JEPs), which serve as intermediates in membrane proliferation .

  • Interaction with Fis1/DRP1: PEX11A-rich patches recruit hFis1, a fission factor that recruits DRP1, enabling membrane constriction and division .

  • Homodimerization: Homodimers may regulate activity, switching between active (monomer) and inactive states .

Recombinant PEX11A in Research Applications

Recombinant PEX11A is utilized in diverse experimental contexts:

ApplicationDetailsSource
Peroxisome MorphologyInduces JEP formation in HEK293 cells; used to study membrane elongation .
Protein InteractionsCo-IP assays to study dimerization with PEX11γ/β and binding to coatomer proteins .
Enzyme ActivityGST-tagged PEX11A used in ELISA, Western blotting, and affinity purification .
Pathway AnalysisInvestigates crosstalk between PPARα and PEX11A in lipid metabolism .

Evolutionary Conservation

PEX11 proteins (α, β, γ) share conserved roles in peroxisomal membrane remodeling. PEX11γ acts as a scaffold, interacting with both PEX11α and β to coordinate elongation and division .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX11A; PEX11; Peroxisomal membrane protein 11A; HsPEX11p; 28 kDa peroxisomal integral membrane protein; PMP28; Peroxin-11A; Peroxisomal biogenesis factor 11A; Protein PEX11 homolog alpha; PEX11-alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PEX11A
Target Protein Sequence
MDAFTRFTNQTQGRDRLFRATQYTCMLLRYLLEPKAGKEKVVMKLKKLESSVSTGRKWFR LGNVVHAIQATEQSIHATDLVPRLCLTLANLNRVIYFICDTILWVRSVGLTSGINKEKWR TRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSF LLLLFRSLKQHPPLLLDTVKNLCDILNPLDQLGIYKSNPGIIGLGGLVSSIAGMITVAYP QMKLKTR
Uniprot No.

Target Background

Function
PEX11A may be involved in peroxisomal proliferation and regulate peroxisome division. It may mediate the binding of coatomer proteins to the peroxisomal membrane and promote membrane protrusion and elongation on the peroxisomal surface.
Gene References Into Functions
  1. Mice lacking PEX11-alpha exhibit normal peroxisome abundance. PMID: 12417726
  2. Cooperation with other transcription factors may differentially influence the selective transactivation of the PEX11alpha gene by various peroxisome proliferator-activated receptor subtypes. PMID: 16567422
Database Links

HGNC: 8852

OMIM: 603866

KEGG: hsa:8800

STRING: 9606.ENSP00000300056

UniGene: Hs.31034

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PEX11A in peroxisome biology?

PEX11A is a key regulatory protein involved in peroxisomal membrane dynamics and proliferation. Research demonstrates that PEX11A functions primarily to promote peroxisome division by directly affecting membrane elongation and protrusion on the peroxisomal surface . While earlier hypotheses suggested PEX11 proteins primarily affect metabolism with division as a secondary consequence, contemporary evidence indicates that PEX11A has a direct mechanistic role in the physical division process of peroxisomes . Methodologically, this has been confirmed through overexpression studies showing that PEX11 proteins can induce peroxisome division even when peroxisomal metabolic pathways are non-functional .

How does PEX11A structurally contribute to peroxisome division?

PEX11A is an integral membrane protein that localizes specifically to the peroxisomal membrane. Functionally, PEX11A promotes membrane protrusion and elongation on the peroxisomal surface, which represents the initial physical step in the peroxisome division process . Within experimental systems, researchers can visualize these membrane changes within 1.5-2 hours after introduction of PEX11 expression constructs . The protein contains specific domains that facilitate membrane interaction, including an amino acid sequence that enables proper insertion and orientation within the peroxisomal membrane. When designing experiments to study PEX11A structure-function relationships, researchers should focus on the 106-219 amino acid range, which contains functionally significant regions for membrane interactions .

What metabolic pathways are affected by PEX11A deficiency?

PEX11A deficiency impacts multiple peroxisomal metabolic pathways, particularly those involving lipid metabolism. Experimental evidence from knockout models shows:

Metabolic ParameterEffect of PEX11A DeficiencyMethodological Approach
Fatty acid β-oxidationDecreasedOxygen consumption measurement
Very long-chain fatty acidsAccumulationFatty acid profiling
Palmitic acid (C16:0) levelsElevated in adipose tissueLipid extraction and GC-MS analysis
Ether lipid synthesisPartially deficientLipidomic analysis

For methodologically robust research, these metabolic alterations should be assessed using a combination of biochemical assays and molecular techniques targeting specific peroxisomal enzymes, rather than relying on a single metabolic marker .

How do we reconcile contradictory findings regarding PEX11A's role in metabolism versus division?

To methodologically address this contradiction, researchers should:

  • Design experiments that specifically uncouple division from metabolism using cell models with targeted disruptions in peroxisomal metabolic enzymes

  • Employ time-course analyses to determine whether division precedes metabolic changes

  • Utilize conditional knockout systems to observe immediate versus long-term effects of PEX11A loss

  • Apply metabolic flux analysis to quantitatively track carbon movement through peroxisomal pathways

This experimental approach reveals that PEX11A affects membrane dynamics directly, while metabolic impairments are likely secondary consequences resulting from altered peroxisome abundance and structure .

What are the optimal methods for studying PEX11A-mediated peroxisome proliferation in vitro?

When designing experiments to study PEX11A-mediated peroxisome proliferation, researchers should consider multiple methodological approaches:

  • Overexpression systems: Utilize DNA constructs encoding human PEX11A, with expression verified through immunoblotting. Observe peroxisome morphological changes through fluorescence microscopy with peroxisomal markers at specific time points (1.5-2h, 4-6h, and 8-12h) after transfection .

  • Gene silencing approaches: Employ siRNA or CRISPR-Cas9 techniques targeting PEX11A specifically, with careful validation of knockdown efficiency before assessing peroxisomal phenotypes.

  • Live-cell imaging: Implement time-lapse confocal microscopy to capture the dynamic process of membrane elongation, constriction, and division in real-time.

  • Biochemical fractionation: Use differential centrifugation techniques to isolate peroxisomal fractions, followed by immunoblotting for PEX11A and other peroxisomal proteins.

  • Induction paradigms: Utilize butyrate treatment (4-phenylbutyrate acid or tributyrin at 5-10 mM) to stimulate PEX11A expression and observe subsequent peroxisomal proliferation .

How can researchers effectively analyze the relationship between PEX11A expression and metabolic disease phenotypes?

To analyze the relationship between PEX11A expression and metabolic disease phenotypes, researchers should implement a multi-level experimental approach:

  • Animal models: Utilize Pex11a knockout mice and assess metabolic parameters under both standard chow and high-fat diet conditions. Key measurements should include:

    • Body composition analysis (fat mass, lean mass)

    • Glucose tolerance and insulin sensitivity tests

    • Serum lipid profiles (triglycerides, cholesterol)

    • Tissue-specific fatty acid profiling

    • Oxygen consumption rates

  • Molecular pathway analysis: Investigate the interaction between PEX11A and peroxisome proliferator-activated receptor-α (PPARα) through:

    • Chromatin immunoprecipitation assays

    • Promoter activity assays

    • Co-immunoprecipitation of regulatory complexes

  • Therapeutic intervention testing: Evaluate potential interventions that modulate PEX11A expression, such as:

    • Direct butyrate administration

    • Probiotic treatment (e.g., Clostridium butyricum) combined with prebiotic fibers (e.g., inulin)

    • Monitoring of peroxisome abundance and metabolic outcomes

The relationship between PEX11A deficiency and metabolic disease is evidenced by findings showing Pex11a−/− mice display:

  • Increased fat mass and decreased skeletal muscle

  • Higher cholesterol levels

  • Impaired glucose tolerance and insulin sensitivity

  • Reduced oxygen consumption

  • Accumulation of very long- and long-chain fatty acids

What are the considerations when using recombinant PEX11A protein in experimental systems?

When utilizing recombinant PEX11A protein in experimental systems, researchers should consider several methodological aspects:

  • Protein expression system selection: Recombinant human PEX11A expressed in HEK 293 cells retains proper post-translational modifications. Bacterial expression systems may provide higher yield but lack mammalian modifications that could be functionally important .

  • Protein purity assessment: Confirm >90% purity using SDS-PAGE analysis and verify low endotoxin levels (<1 EU/μg) if using the protein in cell culture experiments .

  • Functional domain considerations: For structure-function studies, focus on the 106-219 amino acid range, which contains key functional domains. Using truncated versions requires careful validation that the critical domains remain intact .

  • Tag influence: Consider whether fusion tags (such as Fc chimeras) might influence protein behavior. Control experiments with differently tagged versions or tag-cleaved protein can address this concern .

  • Buffer compatibility: Ensure buffer compatibility with the experimental system, particularly when performing membrane interaction studies, as buffer components can significantly affect protein-membrane dynamics.

  • Storage and stability: Optimize storage conditions (-80°C with glycerol) and minimize freeze-thaw cycles to maintain functional activity of the recombinant protein.

What are effective strategies for inducing peroxisome proliferation through PEX11A in experimental models?

Several evidence-based approaches exist for inducing peroxisome proliferation through PEX11A in experimental models:

  • Butyrate treatment: Administration of butyrate derivatives has been shown to induce PEX11A expression and subsequent peroxisome proliferation. Specifically:

    • Tributyrin (5-10 mM) significantly increases hepatic mRNA expression of PPARα and PEX11A

    • 4-phenylbutyrate acid (4-PBA) increases peroxisome abundance and expression of genes involved in peroxisomal fatty acid β-oxidation

  • Probiotic-prebiotic combination: Administration of butyrate-producing probiotics (Clostridium butyricum) together with inulin (dietary fiber) effectively:

    • Reduces adipose tissue mass and serum triglycerides

    • Induces PEX11A expression

    • Increases peroxisome abundance in mice fed both standard chow and high-fat diets

  • Genetic overexpression: For cell culture models, transfection with expression vectors containing the PEX11A gene under strong promoters induces peroxisome proliferation within hours .

  • PPARα agonists: Since PPARα regulates PEX11A expression, treatment with specific PPARα agonists provides an indirect method for inducing PEX11A-mediated peroxisome proliferation.

The methodological timeline for observing effects varies by approach: direct genetic manipulation shows effects within hours, while metabolic interventions typically require days to weeks to manifest measurable changes in peroxisome abundance and function.

How can researchers accurately quantify peroxisome abundance and morphology in PEX11A studies?

Accurate quantification of peroxisome abundance and morphology is critical in PEX11A research. Researchers should employ multiple complementary techniques:

  • Immunofluorescence microscopy:

    • Label peroxisomes with antibodies against peroxisomal marker proteins (e.g., catalase, PMP70)

    • Use high-resolution confocal or super-resolution microscopy for detailed morphological analysis

    • Implement automated image analysis algorithms for unbiased quantification of peroxisome number, size, and shape parameters

    • Include z-stack acquisitions to capture the full three-dimensional distribution of peroxisomes

  • Electron microscopy:

    • Prepare samples using standard fixation protocols optimized for peroxisome preservation

    • Employ immunogold labeling for specific identification of peroxisomes

    • Use stereological methods for quantitative assessment of peroxisome volume, surface area, and numerical density

  • Biochemical fractionation:

    • Isolate peroxisome-enriched fractions through differential centrifugation

    • Quantify peroxisomal marker enzymes (catalase activity, acyl-CoA oxidase activity)

    • Perform western blotting for peroxisomal membrane and matrix proteins

    • Normalize to appropriate housekeeping proteins or total protein content

  • Flow cytometry:

    • Develop protocols for analyzing isolated peroxisomes using flow cytometry

    • Label with fluorescent antibodies or dyes specific for peroxisomal markers

    • Quantify based on size and fluorescence intensity parameters

For robust research outcomes, researchers should combine at least two independent methods for quantification and include appropriate statistical analysis of the data collected.

What are the most sensitive biomarkers for monitoring PEX11A-dependent peroxisomal dysfunction?

When monitoring PEX11A-dependent peroxisomal dysfunction, researchers should utilize multiple biomarkers that reflect different aspects of peroxisome function:

Biomarker CategorySpecific MarkersDetection MethodSensitivity
Lipid MetabolismVery long-chain fatty acids (C22:0, C24:0, C26:0)GC-MSHigh
Polyunsaturated fatty acidsLC-MSModerate-High
Palmitic acid (C16:0) in adipose tissueGC-MSHigh in PEX11A deficiency
Metabolic ParametersFasting glucoseEnzymatic assayModerate
Hemoglobin A1cHPLCModerate
Insulin sensitivityInsulin tolerance testHigh
Gene ExpressionAcyl-coenzyme A oxidase 1qRT-PCRHigh
Hydroxysteroid (17-beta) dehydrogenase 4qRT-PCRHigh
PPARαqRT-PCRHigh
Organelle AbundancePeroxisome numberImmunofluorescenceHigh
PEX11A protein levelsWestern blottingHigh

For comprehensive assessment, researchers should analyze both direct peroxisomal markers (enzyme activities, VLCFA levels) and downstream metabolic consequences (glucose homeostasis, lipid profiles). This multi-parameter approach provides a more complete picture of PEX11A-dependent dysfunction than any single marker .

What are the critical quality control parameters when working with recombinant PEX11A protein?

When working with recombinant human PEX11A protein, researchers should implement rigorous quality control measures to ensure experimental reliability:

  • Purity assessment:

    • Verify >90% purity using SDS-PAGE analysis

    • Document batch-to-batch consistency through analytical techniques

    • Confirm absence of degradation products or aggregates

  • Functional validation:

    • Assess binding to known interaction partners

    • Verify membrane association capability

    • Confirm ability to induce membrane curvature in artificial membrane systems

  • Endotoxin testing:

    • Ensure endotoxin levels are below 1 EU/μg

    • Use limulus amebocyte lysate (LAL) assay for quantification

    • Document endotoxin removal procedures used during purification

  • Post-translational modifications:

    • Verify glycosylation status (PEX11A appears not to be N-glycosylated)

    • Check for appropriate phosphorylation at regulatory sites

    • Assess other relevant modifications through mass spectrometry

  • Storage stability:

    • Determine optimal storage conditions (temperature, buffer composition)

    • Establish shelf-life through activity testing over time

    • Document number of freeze-thaw cycles and their impact on activity

  • Expression system verification:

    • Confirm expression in appropriate system (e.g., HEK 293 cells)

    • Verify protein sequence through mass spectrometry

    • Document any fusion tags or modifications to the native sequence

Implementing these quality control parameters ensures that experimental outcomes reflect the true biological activity of PEX11A rather than artifacts from protein preparation.

How can researchers effectively design gene knockout and knockdown studies for PEX11A?

Designing effective gene knockout and knockdown studies for PEX11A requires careful consideration of several methodological factors:

  • CRISPR-Cas9 knockout design:

    • Target conserved regions essential for protein function

    • Design multiple guide RNAs to increase editing efficiency

    • Include appropriate controls (non-targeting guides, wild-type cells)

    • Confirm knockout through sequencing, western blotting, and functional assays

    • Consider potential compensatory upregulation of PEX11B or PEX11G

  • siRNA/shRNA knockdown approach:

    • Design multiple siRNA sequences targeting different regions of PEX11A mRNA

    • Validate knockdown efficiency through qRT-PCR and western blotting

    • Establish dose-response relationships for optimal knockdown

    • Implement time-course experiments to determine knockdown duration

    • Include scrambled sequence controls

  • Tissue-specific and inducible models:

    • For in vivo studies, consider Cre-loxP systems for tissue-specific deletion

    • Implement tetracycline-inducible systems for temporal control of gene expression

    • Verify tissue specificity through reporter gene expression

    • Document potential leakiness of inducible systems

  • Phenotypic characterization:

    • Assess peroxisome number, size, and morphology

    • Measure metabolic parameters (fatty acid oxidation, VLCFA levels)

    • Evaluate whole-organism physiology (body weight, adiposity, glucose tolerance)

    • Compare acute versus chronic effects of PEX11A deficiency

  • Rescue experiments:

    • Reintroduce wild-type PEX11A to confirm phenotype specificity

    • Test structure-function relationships through mutant rescue constructs

    • Utilize other PEX11 family members to assess functional redundancy

For robust experimental design, researchers should consider the potential for compensatory mechanisms and developmental adaptations, particularly in constitutive knockout models .

What are the methodological considerations for studying PEX11A interactions with other peroxisomal proteins?

When investigating PEX11A interactions with other peroxisomal proteins, researchers should consider several methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies specific for PEX11A or potential interaction partners

    • Include appropriate negative controls (IgG, irrelevant antibodies)

    • Consider crosslinking approaches for transient interactions

    • Verify interactions under various cellular conditions (normal, stress, proliferation)

    • Implement quantitative analysis through western blotting

  • Proximity ligation assay (PLA):

    • Enables visualization of protein interactions in situ

    • Requires specific antibodies against interaction partners

    • Provides spatial information about interaction sites within cells

    • Allows quantification of interaction frequency in different cellular compartments

  • Yeast two-hybrid screening:

    • Use PEX11A as bait to identify novel interaction partners

    • Include appropriate controls to eliminate false positives

    • Verify interactions through secondary methods

    • Consider membrane-specific two-hybrid systems for integral membrane proteins

  • FRET/BRET analysis:

    • Tag PEX11A and potential partners with appropriate fluorophores/luminophores

    • Enables real-time measurement of interactions in living cells

    • Provides information on interaction dynamics

    • Requires careful control experiments to confirm specificity

  • Mass spectrometry-based interactomics:

    • Immunoprecipitate PEX11A under different conditions

    • Identify interaction partners through LC-MS/MS

    • Implement SILAC or TMT labeling for quantitative comparison

    • Validate key interactions through orthogonal methods

  • Functional assays for specific interactions:

    • For coatomer protein binding, implement in vitro binding assays

    • For proteins involved in membrane dynamics, use artificial membrane systems

    • For division machinery components, develop reconstituted systems

Research indicates that PEX11A may interact with coatomer proteins and components of the peroxisomal division machinery. Each interaction study should include appropriate controls and validation through multiple independent methods .

How might PEX11A be targeted therapeutically for metabolic disorders?

Based on current research findings, PEX11A represents a potential therapeutic target for metabolic disorders, particularly those involving dyslipidemia and obesity. Several approaches show promise:

  • Butyrate-based interventions:

    • Direct administration of tributyrin or 4-phenylbutyrate acid induces PEX11A expression and peroxisome proliferation

    • These compounds significantly decrease body weight and increase peroxisomal fatty acid β-oxidation genes

    • Dosage considerations: effective concentrations in mouse models range from 5-10 mM

  • Probiotic-prebiotic combinations:

    • Administration of butyrate-producing probiotics (Clostridium butyricum) with inulin (dietary fiber)

    • This approach reduces adipose tissue mass and serum triglycerides

    • Induces PEX11A and peroxisomal fatty acid β-oxidation genes

    • Increases peroxisome abundance in both normal and high-fat diet conditions

  • PPARα agonist development:

    • Since PPARα regulates PEX11A expression, selective PPARα modulators could target PEX11A indirectly

    • Structure-activity relationship studies should focus on compounds that preferentially enhance peroxisome division

  • Direct PEX11A modulators:

    • Small molecules that enhance PEX11A activity or expression represent a novel therapeutic avenue

    • High-throughput screening approaches using peroxisome proliferation as an endpoint

    • Structure-based drug design targeting PEX11A-membrane interfaces

Therapeutic targeting of PEX11A would likely be most beneficial in conditions characterized by dyslipidemia, reduced fatty acid oxidation capacity, and obesity. The evidence from Pex11a−/− mice, which exhibit increased fat mass, higher cholesterol levels, and impaired glucose tolerance, suggests that enhancing PEX11A function could counteract these metabolic disturbances .

What are the implications of PEX11A research for understanding peroxisomal biogenesis disorders?

Research on PEX11A provides important insights into peroxisomal biogenesis disorders (PBDs) through several mechanisms:

This research direction suggests that therapeutic approaches targeting peroxisome division through PEX11A modulation might provide benefits across multiple types of PBDs, even those without primary PEX11A mutations .

How does PEX11A function integrate with broader cellular stress response pathways?

PEX11A function intersects with several cellular stress response pathways, representing an important area for future research:

  • Lipid homeostasis stress:

    • PEX11A expression is induced under conditions of lipid overload

    • This represents a compensatory mechanism to increase peroxisomal capacity for fatty acid oxidation

    • Pex11a−/− mice show exacerbated metabolic dysfunction on high-fat diets, suggesting impaired adaptation to lipid stress

  • Oxidative stress integration:

    • Peroxisomes are major sites of reactive oxygen species (ROS) production and detoxification

    • PEX11A-mediated changes in peroxisome abundance likely affect cellular redox balance

    • Research should investigate whether PEX11A expression responds to oxidative stress conditions

  • Inflammatory response connections:

    • Metabolic dysfunction in Pex11a−/− mice may trigger inflammatory pathways

    • Research should explore whether PEX11A modulation affects inflammatory cytokine production

    • The connection between peroxisome function and inflammasome activation represents an important research direction

  • Mitochondrial-peroxisomal crosstalk:

    • Peroxisomes and mitochondria coordinate cellular responses to metabolic stress

    • PEX11A-mediated changes in peroxisome abundance likely affect this coordination

    • Investigating how PEX11A deficiency impacts mitochondrial function would provide insights into integrated stress responses

  • Endoplasmic reticulum stress:

    • Peroxisomes form membrane contact sites with the ER

    • PEX11A may influence these connections through its role in membrane dynamics

    • Research should explore whether PEX11A deficiency triggers ER stress responses

Understanding these integrated stress response pathways may reveal new therapeutic approaches for metabolic disorders and explain the complex phenotypes observed in peroxisomal disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.